include stdio.h #include math.h double fdet ( float d, float c, int n ); int fau ( float d, float c, int n, double ua[] ); void fld ( float d, float c, int n, double ld[] ); void fv ( int n, double vld [] ); void main() { int i, i1, j, j1, n = 5 ; float d = 2., c = 1., det ; double ld[ 10 ], ua[100], vld [100]; ...

Еще в разделе: (Показать все результаты (>546) - num-anal.srcc.msu.ru/ )

• http://num-anal.srcc.msu.su/meth_mat/prac_alg/arfil/symfor1.txt
• БЧА НИВЦ МГУ. ZF30R. Решение системы уравнений общего вида
• БЧА НИВЦ МГУ. IA80R_C. Аппроксимация рациональными функциями (равномерная)

... Only by numerical simulation. ... moment T (K) Dipole moment (D) Experiment Other example: Diffusion constant 200 250 298 350 400 2.40 2.37 2.48 2.59 2.80 2.25 The Distribution functions: radial distribution function 1 g (r) = N t =1 j i N TS N pair ( r - rij ) The Distribution functions: radial distribution function CC def 2 Work mode ґ computer related 1) Ї Perform simulation , create trajectory file Ї Calculate properties timestep by timestep 2) Ї Perform ...

Еще в разделе: (Показать все результаты (>14) - www.elch.chem.msu.ru/ )

Institute of Theoretical Geophysics . ... Consortium for Electromagnetic Modeling and Inversion (University of Utah) . SJ Geophysics Ltd . INFOMINE / Geomine - Geological Exploration and Technology (Links collection) . ... Zonge Engineering: Geophysical Modeling . CEMI software developed at the Center for Electromagnetic Modeling and Inversion (University of Utah). ... AGI Res3Dinv - 3D Resistivity Inversion Software . RINVERT - Resistivity Models and Modeling (or Modelling) Software . ...

Еще в разделе: (Показать все результаты (>71) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• TES. Field example.
• TES tecnology. MSU.

akishin@hep.sinp.msu.ru A major concern for spacecraft is internal electrostatic discharge (IESD), a form of spacecraft charging. ... 100 . ... 3-6] , 30-100 (1987-1989.) ... 1013 /2 30-100 [3]. 112,-120 120. 700, 25 ґ 100 , , 0,25 , 50, 120 . ... 105 /, ~51010 /2 [2]. 30 ~1010 /2 [ 2 ]. ... 100 ~1011 /2 50 , Jy = 1015 /2c. 30 J~105 /2c. , -100 , ~1010 . ... 4 [10]. , r, , , , n~1. , , -100, , n, 105- 1010 , . ... 30 , , 51010-1011 /2, .. , - [2,3]. 30-100 , , 105-106 ./2 c : (-100) В 50. ...

Еще в разделе: (Показать все результаты (>142) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/Round%20Table%20Discussion/Spillantini.pdf
• http://nuclphys.sinp.msu.ru/school/s09/09_24.pdf

... The 1973 eruption on the island of Heimaey is a classic example of the struggle between man and volcanoes. With a heroic effort the people of Iceland saved the town of Vestmannaeyjar and the country's most important fishing port. ... The island of Heimaey with the growth of the island in 1973, the location of the eruptive fissure, and the location of Eldfell, the 1973 cone. ... View of Heimaey before the eruption. ... Eldfell and the 1973 lava flows are just beyond the town. ...

Еще в разделе: (Показать все результаты (>359) - geo.web.ru/ )

• Commission on the chemistry of volcanic gases (CCVG). IAVCEI 11th Gas workshop
• Texas University at Austin
• dwelling

... О факультете . ... Master In Ecology . ... Master (MSc) . ... A Master will be able to successfully deal with conceptual issues and practical problems related to various subflields of ecology and environmental science. ... Enables the students to develop biopolicies to deal with ecological problems caused by environmental pollution, the disruption of the ecological matrix of an area, and biodiversity-endangering factors. ... Lectures . ... Д 501.001.20 - все защиты . ... Биологический факультет МГУ ...

Еще в разделе: (Показать все результаты (>3) - www.bio.msu.ru/ )

• Master In Nanobiotechnology ? Биологический факультет МГУ

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

Welcome to ASC14 To whom it may concern With the supports from the High Performance Computing (HPC) experts and organizations, the ASC13 Student Supercomputer Challenge has concluded with great success. ... We are calling for registration and preliminary contest preparation. ... Some of them may finally take HPC as a career option, such as some students from National Defense University team have already contributed to the Tianhe-1A and Tianhe2. ... Award Overall Gold Winner: 100K RMB (~16000 USD) . ...

Еще в разделе: (Показать все результаты (>2) - smu.cmc.msu.ru/ )

... 2 Ї ґ , , Ї ґ Ї ґ , 03.12.2015 . ... 14 03.12.2015 Ї Ї Ї 03.12.2015 . ... Verifier Uni ve rsi ty of Te x as 2013 Anteater Uni ve rsi ty of Il l i noi s 2011 FlowChecker Uni ve rsi ty of North Carol i na 2010 VERMONT Network disjoint Port #02 Port #03 h2 h3 s1 Port #01 h1 Port #04 h4 main: disjoint() := Forall[x, out_x, y, out_y: !R(x, out_x) or !R(y, out_y) or x[p] == out_y[p] and out_x[p] == y[p] or x VERMONT proxy CLI Packets are delivered through the control plane We can block them! ...

Еще в разделе: (Показать все результаты (>6) - lvk.cs.msu.su/ )

... include stdio.h # include stdlib.h int main( int argc, const char* argv[]) { FILE* f; int c, wordCnt = 0, inWord = 0; if (argc 2) { printf ( Use: %s filename\n , argv[0]); return 1; } f = fopen(argv[1], r ); if (f == NULL) { printf ( Can't open file: %s\n , argv [1]); return 1; } while ((c = fgetc(f)) if (!isspace(c)) if (! inWord ) { ++wordCnt; inWord = 1; } } ... int main() { enum {RUNNING, STOPPED} state; state = RUNNING; state = STOPPED; } RUNNING STOPPED Ї : 1. ...

Еще в разделе: (Показать все результаты (>3) - savenkov.lvk.cs.msu.su/ )

• http://savenkov.lvk.cs.msu.su/mc/lect01.pdf
• http://savenkov.lvk.cs.msu.su/mc/lect04.pdf

... defmacro defprinter ( name args &body body ) . ... body ) ) . ... defprinter :property ( type name &rest body ) . print-statement-with-body stream body nil "public ~a ~a" type name ) ) . ... defprinter :get ( &rest body ) . print-statement-with-body stream body nil "get" ) ) . ... defprinter :constructor ( name args &rest body ) . ... defprinter :class ( name &rest body ) . print-statement-with-body stream body t "public class ~a" name ) ) . ... defprinter :namespace ( name &rest body ) . ...

Еще в разделе: (Показать все результаты (>2) - depni.sinp.msu.ru/ )

SDPpred: a tool for prediction of amino acid residues that determine differences in functional specificity of homologous proteins . ... Amino acid residues that determine differences in protein functional specificity and account for correct recognition of interaction partners, are usually thought to correspond to those positions of a protein multiple alignment, where the distribution of amino acids is closely associated with grouping of proteins by specificity. ... As colored columns of the alignment. ...

Еще в разделе: (Показать все результаты (>5460) - monkey.belozersky.msu.ru/ )

• ETS numeration assumed
• SDP home page
• Example of supporting positions

Model Answer This model answer has been written by an examiner as an example of a very good answer. However, please note that this is just one approach out of many possible ways. ... The author considers two solutions for/to the task: empirical (experimental) and geometric (hypothetical, theoretical). The article goes on to say that there is, actually, a simple way of ultimate connection. ... The height values of the two tilings differ in one flip in the centre of the hexagon. ...

Еще в разделе: (Показать все результаты (>22) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/Academic_English_part1.pdf
• http://www.eng.math.msu.su/download/Academic_English_part3.pdf
• http://www.eng.math.msu.su/download/dictionary.pdf