Irena Lasiecka ( University of Virginia ) . Nikolai Melnikov (CEMI / MSU) . Mikhail Zelikin (MSU / Steklov Institute) . G. Avalos ( University of Nebraska , USA ) . V. Borisov (MSU, Moscow) . ... O. Emanouvilov ( Colorado State University , USA ) . A. Fursikov (MSU, Moscow) S. Hansen ( Iowa State University , USA ) R. Hildebrand ( Joseph Fourier University , France) V. Komornik ( University of Strassburg, France ) A. Kowalewski ( Institute of Automatics, Poland ) . ... Moscow) . ...

Еще в разделе: (Показать все результаты (>2) - oc.cs.msu.su/ )

Space Weather . ... Models . Data . ... Space Weather Analysis Centre of SINP MSU provides information about the current state of near-Earth's space. Information Services ( SWX ) on the website of the center provide access to current data describing the level of solar activity, geomagnetic and radiation state of the magnetosphere and the heliosphere in the real time. For data analysis, the models of the space environment, working in off-line as well as on-line mode have been implemented. ...

Еще в разделе: (Показать все результаты (>7) - swx.sinp.msu.ru/ )

• SWX - Прогноз Dst

... heat and mass transfer; . kinetic theory of gases; . ... The technique had been developed for calculating destruction of melting vitreous bodies in hypersonic gas flows taking into account the internal radiative transfer. ... The problem of flow in the chemically non-equilibrium boundary layer at a stagnation point of blunt body had been solved by the asymptotic method and formulas for the heat and diffusion fluxes to a surface of any catalycity had been obtained. ...

Еще в разделе: (Показать все результаты (>9) - lab106.imec.msu.ru/ )

The Astronomical Journal welcomes new submissions at IOP Publishing . ... From: Andrew Wray < andrew.wray@iop.org > . ... On behalf of the IOP-AAS Project Team, I am delighted to announce that IOP Publishing is now processing all new submissions to the AJ. Submitting a new article . To submit a new article to the journal, go to http://authors.iop.org/aj , where you will find our beta version of the new AJ web submission site. ... Refereeing an article . ... IOP Publishing . ...

Еще в разделе: (Показать все результаты (>79) - sai.msu.ru/ )

• General Catalogue of Variable Stars: What's new.

Department of Ethnology . ... Students in the department, researching ethnology and all of its applied aspects, listen to the courses "ethno-sociology" (Z.U.Makhmudova), "ethnic cartography" (N.L.Mekhedov), "special techniques of ethnology" (N.L.Mekhedov, O.V.Solopova), "field research techniques" (L.B.Zasedateleva), "interethnic conflicts and possible paths for their resolution" (V.V.Pimenov), "ethnological aspects of law (legal anthropology)" (O.V.Solopova), "applied ethnology" (E.V.Mis'kova). ...

Еще в разделе: (Показать все результаты (>175) - hist.msu.ru/ )

• Department of Modern and Contemporary History of European and American...
• "Novaya i noveishaia istoria" Journal
• International Summer School 2011 "Russian History and modernity: the

SELECT data_key, data_value FROM xf_data_registry WHERE data_key IN ('options', 'languages', 'contentTypes', 'codeEventListeners', 'cron', 'simpleCache', 'routesPublic', 'bannedIps', 'styles', 'nodeTypes', 'smilies', 'bbCode', 'displayStyles', 'trophyUserTitles', 'reportCounts', 'moderationCounts') . ... Select Type . ... Ref . ... SIMPLE . ... PRIMARY . ... const . ... library/XenForo/ Autoloader.php . ... library/Zend/Registry.php . ... library/Zend/Config.php . ... library/Zend/Db/Select.php . ...

Еще в разделе: (Показать все результаты (>26) - osk.msu.ru/ )

• http://osk.msu.ru/forum/members/adollekautoto.2142/?_debug=1
• http://osk.msu.ru/forum/members/arbimeorirm.2192/?_debug=1
• http://osk.msu.ru/forum/members/catyfopwbex.2168/?_debug=1

... Human pro-B-type natriuretic peptide is processed in the circulation in a rat model. ... BACKGROUND: The appearance of B-type natriuretic peptide (BNP) in the blood is ultimately caused by proteolytic processing of its precursor, proBNP. ... RESULTS: ProBNP was effectively processed in the circulation into BNP (1-32) and various truncated BNP forms as confirmed by gel filtration and MS analysis. ... CONCLUSIONS: In rats, processing of human proBNP to active BNP occurs in the circulation. ...

Еще в разделе: (Показать все результаты (>63) - biochem.bio.msu.ru/ )

• Probable participation of 14-3-3 in tau protein oligomerization and...
• Processing of pro-brain natriuretic peptide is suppressed by O-glycosylation in
• Processing of pro-B-type natriuretic peptide: furin and corin as candidate

... Geography of World Economy . ... Recreational Geography and International Tourism . ... Physical Geography and Landscape Science . ... Field stations . ... Educational council . Science . ... International commission on continental erosion . ... Field training . ... Type of field courses . ... Interuniversity council for erosion and fluvial.. ... International programme in Natural Resource Management and Law offers a unique combination of Natural and Environmental Sciences and Science of Law. ...

Еще в разделе: (Показать все результаты (>110) - eng.geogr.msu.ru/ )

• ICCE events
• Department of Meteorology and Climatology
• Geoecology of the Northern Territories

... Surface plasmon-polaritons (SPPs) is a collective oscillation of light and electrons that propagate at the boundary between metal and dielectric. ... Ultrafast Laser Pulse Shaping by Plasmonic Crystals . In our group, controllable reshaping of a femtosecond laser pulse reflected from a plasmonic crystal based on 1D polymer grating with period of 750 nm covered by 50љnm silver film. ... Pulse duration ? ... nonlinear crystal. ... Ultrafast Polarization Pulse Shaping with Plasmonic Crystals . ...

Еще в разделе: (Показать все результаты (>76) - nanolab.phys.msu.ru/ )

Cell Biology International 27 (2003) 293­294 Cell Biology International www.elsevier.com/locate/jnlabr/ycbir Short communication Microtubule dynamics in living cells : direct analysis in the internal cytoplasm Ivan A. Vorobjev a a,* , Irina B. Alieva a, Ilya S. Grigoriev b, Gary G. Borisy c Laboratory of Cell Motility, A.N. Belozersky Institute, Moscow State University, Moscow, Russia b Department of ... These data demonstrate that MT growth is impeded at the cell margin. ...

Еще в разделе: (Показать все результаты (>29) - cellmotility.genebee.msu.ru/ )

• http://cellmotility.genebee.msu.ru/html/articles/grigoriev99.pdf

... Revision Log Mode: Stop on copy Follow copies Show only adds and deletes View log starting at and back to . ... edit) . ... 5 years . me.dendik . ... Added rule to evade trapping yourself while eating for e4 snake . ... Added "run mostly forward" rule to e2 snake . ... Changed display names in e2, e4 snakes (they were both Example тАж . ... e4 snake now tries to zig-zag . ... Added two smarter snakes: e2 and e4 . ... snakes added . ... Added example empty snake . ... Added example snake . ...

Еще в разделе: (Показать все результаты (>563) - kodomo.cmm.msu.su/ )

... B Design and developmentof a new vacuum chamber for the tests of Q-factors in suspension's modes . ... E New SQL free principle of coordinate monitoring of the test mass . F Appendix I . ... The achieved p new resolution 2 10;11cm= Hz was su cient to record Brownian vibration with relative accuracy better than 10% (see details in Appendix I). ... See details in Appendix IV) E. New SQL free principle of coordinate monitoring of the test mass The new concept of quantum measurement | ...

Еще в разделе: (Показать все результаты (>94) - hbar.phys.msu.ru/ )

• http://hbar.phys.msu.ru/gorm/fomenko/fomenko10.pdf
• Ответ Wally на книгу "Крах С14"
• The jump of the second derivative of the moon's elongation

NUCLEAR ASTROPHYSICS Yu. ... ейСЦгъ кДлтакьыфЦвль ЗлЦгЦззйв 68 ї иВМЛУМКНВ,Л~ ы.щ., 1998 1965 "", , , , 3 . ... иЦзайзЬдЦЗау ы.щ. ьСЦкзДь ДлнкйоабадД 69 100 (1012 ), , . ... 100 1 1 . ... 1, , , 1 1010 . ... 40 (1,3 109 ) 87 232 40 Ar, Sr, Pb, Rb (4,8 1010 ) 87 Th (1,4 1010 ) U (4,5 109 ) 208 206 238 Pb]. ... 238U - 238, r- - 242, 246 250. 250 238U. 235U 238U, r- . ... s-, ( 1,64 1,0 ( 235 C 15 + N 1,0 (, ) U/ 238 U) "" CNO "" CNO 238 235 , 235U/ 238U = 0,29 U/ 238U = 0,65 235U/ 238U = 1,21 109 . ...

Еще в разделе: (Показать все результаты (>158) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/XFEL/XFEL-TDR_Chapter08_Commissioning-Operation.pdf
• http://nuclphys.sinp.msu.ru/thgr/eng/ch5.pdf
• http://nuclphys.sinp.msu.ru/nseminar/08_09_09.pdf

The Department of Talented Youth Affairs and Professional Orientation . ... News . ... Older posts . Newer posts . Posted on 03.06.2014 by admin . ... Dean of the Faculty of Biology, MSU (1973-2003) and the school were devoted to topical areas of basic research in biology and biotechnology of microalgae, new methods of Continue reading . Posted in News | ... 2016 - The Department of Talented Youth Affairs and Professional Orientation ...

Еще в разделе: (Показать все результаты (>168) - talant.msu.ru/ )

• admin | The Department of Talented Youth Affairs and Professional Orientation |
• admin | Управление профессиональной ориентации и работы с талантливой молодежью
• Our Graduate Will Represent Lomonosov Moscow State University during the

Draft Dr. Paul Twomey President and Chief Executive Officer Internet Corporation for Assigned Names and Numbers (ICANN) Speech to Third International Forum Partnership Among State, Business Community and Civil Society in Ensuring Information Security Garmisch-Partenkirchen, Germany Monday, 20 April 2009 Dear Vladislav Petrovich, Dear Alexei Anatolievich, Distinguished guests, Ladies and Gentlemen. ... ICANN itself is evolving, mirroring the changing nature of the global Internet community. ...

Еще в разделе: (Показать все результаты (>23) - iisi.msu.ru/ )

• http://www.iisi.msu.ru/UserFiles/File/bayern2009/global_dns.pdf
• Институт Проблем Информационной Безопасности

... Инженерия академического текста . Что такое хороший аналитический текст љ(учебное эссе, курсовая работа, диплом или диссертация, статья) ?љ Ясно, что љне результат соблюдения проформы (введение љ - основная часть љ - љ заключение), не монтаж из ?правильных? тезисов , подкрепленных љпримерами , љи не потокљ фактовљ вперемежку сљ личными соображениями .љ ... Учебное пособие для вузов?. М., 2015. ... Пятница, 19 февраля 2016 . 14.4 0 -16.10 . ... Comments (0) . ... Name (required) . ...

Еще в разделе: (Показать все результаты (>13) - discours.philol.msu.ru/ )

• Free verse and free dance
• Department

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>48) - observ.pereplet.ru/ )

... Seminar archive . ... Type Ia Supernovae (SNe Ia) have an important role to measure a distance to an anonymous galaxy because they have a good correlation of the decline rates of the light curves with the absolute luminosity. ... First, super-Chandrasekhar SNe which have extremely high luminosity, slow decline rate of the light curves, slow expansion velocity and strong carbon features. ... As another example of diversity of SNe Ia, I would like also to introduce Type Iax SNe. ... All seminars: . ...

Еще в разделе: (Показать все результаты (>20) - master.sai.msu.ru/ )

• SAI Space Monitoring Laboratory

... Control of the Self Assembly Processes in a Droplet of a Colloidal Solution by an Acoustic Field O. V. Rudenkoa, P. V. Lebedev Stepanovb, V. A. Guseva, A. I. Korobova, B. A. Korshaka, N. I. Odinaa, M. Yu. ... The self assembly in the course of solvent evapora tion occurs owing to capillary forces, which displace the particles in the near surface layers of the solution as the volume of the latter decreases. ... For simplicity, we replace the actual droplet on a solid substrate by a plane liquid layer...

Еще в разделе: (Показать все результаты (>43) - acoustics.phys.msu.ru/ )

• http://acoustics.phys.msu.su/teachers/gusev_files/diff2011.pdf
• http://acoustics.phys.msu.su/teachers/gordienko_files/localization_eng.pdf