... Seminar archive . ... Type Ia Supernovae (SNe Ia) have an important role to measure a distance to an anonymous galaxy because they have a good correlation of the decline rates of the light curves with the absolute luminosity. ... First, super-Chandrasekhar SNe which have extremely high luminosity, slow decline rate of the light curves, slow expansion velocity and strong carbon features. ... As another example of diversity of SNe Ia, I would like also to introduce Type Iax SNe. ... All seminars: . ...

Еще в разделе: (Показать все результаты (>21) - master.sai.msu.ru/ )

• SAI Space Monitoring Laboratory

... License . ... This program is free software: you can redistribute it and/or modify . it under the terms of the GNU General Public License as published by . the Free Software Foundation, either version 3 of the License, or . ... This program is distributed in the hope that it will be useful, . ... GNU General Public License GNU General Public License for more details. ...

Еще в разделе: (Показать все результаты (>15) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

... Guidelines for Paper Submission . ... The program committee will schedule both oral and poster sessions. The abstract and summary of both oral and poster papers are published in the same manner in the Conference Program and the Technical Digest on CD-ROM. ... Oral Sessions . ... Poster Sessions . ... For poster sessions, authors are provided with bulletin boards on which to display their papers, along with a sign indicating their paper numbers, and pushтАУpins or adhesive tape. ... Program . ...

Еще в разделе: (Показать все результаты (>10) - iconolat13.phys.msu.ru/ )

• Invited speakers

... id #1356 . Biology Direct [Biol Dir] . Common information . ... no information] . ... since 2006-01-31 till today . ... subscription - $0,single article - $0 . ... biology . ... FREE-access journal! ... http://www.biology-direct.com/ . ... 2006-01-31 . today . ... http://www.biology-direct.com/article.. ...

Еще в разделе: (Показать все результаты (>1059) - journals.genebee.msu.ru/ )

Sample Submission Form for Example Measurements In order to provide the best and most appropriate measurement/results, the customer is asked to please fill in the following form and enclose it with the sample. This form or equivalent information is required prior to the sample measurements. ... WITec can not provide specialised sample preparation. Measurement Goal: What's the goal of the measurement? ...

Еще в разделе: (Показать все результаты (>25) - nano.msu.ru/ )

LangueDOC . ... Texts . ... Apply the program BoxReader to transform the Toolbox document into an XHTML formtat that uses nested tags to represent structure. ... Apply an XSLT stylesheet to transform the XHTML file into the content.xml of the OpenOffice format. ... Add the resulting content.xml into a complete OpenOffice text document replacing the old content.xml . ... Apply the converse XSLT transform to obtain the document in the XHTML nested-span format that can be displayed in the browser . ...

Еще в разделе: (Показать все результаты (>289) - www.philol.msu.ru/ )

• Title: Russian Language Training via INTERNET. Internet-based educational

... О Школе . ... Магистерская программа Высшей школы бизнеса МГУ получила международную аккредитацию ABEST21 . ... В 2015 году Высшая школа бизнеса МГУ подтвердила статус одной из ста лучших бизнес-школ мира и получила награду высшей категории как 'бизнес-школа, имеющая наивысшее международное влияние'. 21.10.2015 . ... Декан Высшей школы бизнеса МГУ О.С. Виханский получил награду от Международной ассоциации бизнес-образования ABEST21 за 10-летний вклад в работу ассоциации в качестве ее Вице-президента...

Еще в разделе: (Показать все результаты (>4440) - www.mgubs.ru/ )

• Вестник Московского университета | Высшая школа бизнеса МГУ им. Ломоносова

Commissioning and operation 8 Commissioning and operation General considerations In the following, general aspects of commissioning and operation are discussed, the transition from construction to operation is outlined and the resources required during this transition, as well as for full operation of the facility, are summarised. ... 8.3 User operation The European XFEL is conceived as a multi-user facility. ... The total amount of scheduled user beam time per year is expected to be 4,800 hours. ...

Еще в разделе: (Показать все результаты (>144) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/XFEL/XFEL-TDR_Chapter09_Project%20Management.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/240809/Weiser.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/200809/Stodolsky_nuta.pdf

... E-mail . ... Этот e-mail защищен от спам-ботов. Для его просмотра в вашем браузере должна быть включена поддержка Java-script . ... Ведущий специалист . ... Главный специалист . ...

Еще в разделе: (Показать все результаты (>11) - www.ied.msu.ru/ )

... Structure of Data . ... Catalog . ... The SAI OCL Catalog site provides several VO-enabled modes of operation: . VO-enabled catalog data analysis from a browser . ... Endpoint URL is http://ocl.sai.msu.ru/catalog/conesearch/ . ... VO-enabled catalog analysis from a browser . Presently, this recipe works with Firefox (Windows, MacOS, Linux), Internet Explorer (Windows) and Opera (Windows) browsers with Java plugin 1.6 installed. ... Main TOPCAT window with SAI OCL catalog loaded will appear. ...

Еще в разделе: (Показать все результаты (>210) - ocl.sai.msu.ru/ )

• SAI OCL Catalog Berkeley 53
• SAI OCL Catalog Berkeley 72
• SAI OCL Catalog Berkeley 71

May 12, 1998 NOTES from May 9, 1998: The format of the Solar Event Lists was changed to include a standard SEC style header. ... Please send comments and suggestions to sec@sec.noaa.gov # # Missing data: //// # # Edited Events for 1998 May 11 # # Event Begin Max End Obs Q Type Loc/Frq Particulars Reg# #------------------------------------------------------------------------------- 2560 A0146 //// 1225 HOL ... The UT day of the event's begin time is the UT day of the list. ...

Еще в разделе: (Показать все результаты (>11) - dbserv.sinp.msu.ru/ )

... Chilingarian, I., Melchior, A.-L., Zolotukhin, I. 2010: Analytical approximations of K -corrections in optical and near-infrared bands , MNRAS, v. 405, p. 1409 (also arXiv:1002.2360) . ... Calculator . ... calculate spectral energy distributions , K-corrections calculator , UKIDSS YJHK , K-corrections of galaxies , spectral based k-corrections , SDSS filter set K-corrections , K correction code IDL , kcorrect IDL C , . ...

Еще в разделе: (Показать все результаты (>10) - kcor.sai.msu.ru/ )

• K-corrections calculator (version 2010)

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

... Таня Трубичева, Коля Чеботарев, Сергей Меженный, Андрей Лебедев . ... Слева направо: Паша Зинюков, Булат Мавлюдов, Галя Ивутина (выше), Муся Григорян, Саша Игнатьев. ... Слева направо: 1)Аня Ноздрачева, 2)Дима Китаев, 3)Миша Ноздрачев, 4)Женя Цибиков, 5)Костя Фирсов, 6)Володя Трифонов, 7)Тамара Голубицкая, 8)Таня Михайлина, 9)Саша Игнатьев, 10)Валя Рябинкина, 11)Таня Чеботарева, 12)Оля Гусева, 13)Коля Чеботарев. ... Таня Гужва, Таня Немченко, Даниэль Усиков перед спуском в снежную . ...

Еще в разделе: (Показать все результаты (>12) - optics.sinp.msu.ru/ )

• polist99
• zagedan

... Co-Chairman of the Forum ­ Deputy Secretary of the Security Council of the Russian Federation , Sergey M. BURAVLEV Co-Chairman of the Forum ­ Adviser of the Security Council of Russian Federation , Director of Lomonosov Moscow State University Institute of Information Security Issues, Vladislav P. SHERSTYUK Co-Chairman of the Forum ­ Special Representative of the President of the Russian Official languages: Russian, English. ...

Еще в разделе: (Показать все результаты (>27) - iisi.msu.ru/ )

• http://www.iisi.msu.ru/UserFiles/File/bayern2009/global_dns.pdf
• Институт Проблем Информационной Безопасности

NATO Publishing Unit P.O. Box 17 3300 AA Dordrecht A U T H O R 'S D A T A B A S E E N T R Y S H E E T (to be submitted together with the scientific paper ) REFERENCE: ARW978587 TITLE OF THE NATO MEETING/ NATO ASI SERIES VOLUME : Use of Humic Substances to Remediate Polluted Environments: from Theory to Practice NAME OF THE DIRECTOR: Dr. Norbert ... The total space available for keywords and abstract of your paper is 900 characters (approx. 100 words). ...

Еще в разделе: (Показать все результаты (>127) - mgumus.chem.msu.ru/ )

• http://www.mgumus.chem.msu.ru/arw/natocamera-ready.doc
• Instructions for book-contributors
• Humates NATO ARW Home Page

... Formulation of the problem ­ angle about the mass center C IC = mR 2 ­ central moment of inertia m and R ­ mass and radius of the hula-hoop k ­ coefficient of viscous friction r ­ radius of the waist FT ­ friction force N ­ reaction force ­ angle between x and CO x = a sin t , IC m m Ё +k (R - (R - y = b cos t = -FT R r ) = m (x sin + y cos ) + FT Ё Ё Ё r ) 2 = m (x cos - y sin ) + N Ё Ё (R - r ) = R ­ non-slippage where constants 0 mod 2 are defined from + µ cos 0 = 0. ...

Еще в разделе: (Показать все результаты (>9) - belyakov.imec.msu.ru/ )

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... Unless in many other approaches to the analysis of different signal coupling, the information entering the analysis of synchronization in our approach is explicitly represented in the form of elementary, instantaneous events (the change-points). ... Hence the use of correlation/coherency estimates in parallel with change-point analysis seems to be quite rational. ...

Еще в разделе: (Показать все результаты (>58) - brain.bio.msu.ru/ )

• Change-points in EEG components with different pattern
• Change-points at different levels of the hierarchy of EEG segmental...

Intel Thread Checker 2- pozdneev@gmail.com . Intel Thread Checker 14 2008 1 / 26 1 Intel Thread Checker 1: Intel Thread Checker 2: Intel Thread Checker 14 2008 2 / 26 2 3 4 5 6 7 ( ) Microsoft Windows Intel Thread Checker / «» (Intel Software Development Tools Intel(R) Thread Checker x.x) icl ( Intel Software Development Tools Intel C++ Compiler xx.x.xxx C++ Build Environment for applications running on . ... 1 |Write -> |Err|4|omp|Memory read of glb_primes_found at |"prim|"prim| ... Read |or | ...

Еще в разделе: (Показать все результаты (>5) - angel.cmc.msu.ru/ )

• Index of /~basrav/supercomp2010

ScienceDirect Nuclear Instruments and Methods in Physics Research B journal homepage: www.els e vier.com/locate/nimb Behavioral modeling of SRIM tables for numerical simulation S. Martinie 1, T. Saad-Saoud, S. Moindjie, D. Munteanu, J.L. Autran Aix-Marseille University and CNRS, IM2NP, UMR 7334 - Facultй ... Escadrille Normandie Niйmen, F-13397 Marseille Cedex 20, France article info abstract This work describes a simple way to implement SRIM stopping power and ...

Еще в разделе: (Показать все результаты (>95) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/LIIWM/nature446_07_627Kabachnick.pdf