The Department of Talented Youth Affairs and Professional Orientation . ... Projects . ... From 1 to 6 July 2014 there were held the third championship of the ?SanSat in Russia? which took place in Dubna (Moscow) ? ... CanSat is a model of microsatellite weighing about 350 grams. CanSat project started in 1999. ... Participants at the third championship were offered a large educational and excursion programs. ... 2016 - The Department of Talented Youth Affairs and Professional Orientation ...

Еще в разделе: (Показать все результаты (>49) - talant.msu.ru/ )

• Our Graduate Will Represent Lomonosov Moscow State University during the
• News | The Department of Talented Youth Affairs and Professional Orientation |

Migration networks and the early socialistic movement in Amsterdam, a case study Sandra Kleine Staarman University of Amsterdam Within the larger view of migration in nineteenth century's Europe, my thesis deals with Germans migrating to Amsterdam in the period 1849-1853. ... The core question of my thesis is related to earlier research about the history of the socialistic movement in Amsterdam by the Dutch historian Dennis Bos. ... The municipal archives of Amsterdam constitute such a source. ...

Еще в разделе: (Показать все результаты (>9630) - hist.msu.ru/ )

• The role of wine tax-farming system in the forming of large capitals in Russia
• Confessiones et Nationes. Confessional and Ethnic Traditions in Shaping
• История

Gordov E.P., Fazliev A.Z., Lykosov V.N., Okladnikov I.G., Titov A.G. Development of a web-based information-computational infrastructure for the Siberia Integrated Study. In: 'Environmental Change in Siberia. Earth Observation, Field Studies and Modelling' (Advances in Global Change Research, v. 40), 2010, p. 233-252. ... Ключевые слова: Environmental monitoring and assessment, climate, information systems, meteorology, regional climate change ...

Еще в разделе: (Показать все результаты (>108) - srcc.msu.ru/ )

• D.Sokoloff, R.Arlt, D.Moss, S.H.Saar, I.Usoskin Sunspot cycles and Grand
• Laboratory of Informatics
• Brandenburg A., Sokoloff D., Subramanian K., Current status of turbulent dynamo

news ]] . ... Highlight news: CompHEP is in the top rating list on The OpenScience Project . ... 16/03/2009 New official version of CompHEP (4.5.1) is available. ... 14/11/2006 Two new versions of CompHEP-PYTHIA interface (cpyth-1.2.7 and cpyth-2.0.4) are available. ... 13/09/2006 A new version of CompHEP-PYTHIA interface and a new interface CompHEP-HERWIG has been released. ... 01/07/2006 Talk on new physics with CompHEP by M.Dubinin at Tools for SUSY and the New Physics (LAPP, 26-28 June 2006). ...

Еще в разделе: (Показать все результаты (>11) - comphep.sinp.msu.ru/ )

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>380) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~alex2308/align/delta.fasta
• Department of animal cell biochemistry - Staff and contacts

The Ecological Cooperation Project is the first large-scale children's network project in Russia. This project was founded on the principles of development and achievement of widespread nature awareness among Russian school children through the establishment and unification of numerous childrenтАЩs ecological projects. ... Nature Protected Areas . ... The Project is open for cooperative learning, and any childrenтАЩs ecological organization or group is welcome to participate. ...

Еще в разделе: (Показать все результаты (>15) - www.ecocoop.ru/ )

• For three and half years of activity the participants of Ecological Cooperation

... Algebraic Topology Conference . ... 9-13 September 2002 . ... New Contexts for Stable Homotopy Theory . ... 2 September - 20 December 2002 . 30 April 2002 . ... Geometric Topology II New! ... 21 - 28 April 2003 . 5-th Conference on " Geometry and Topology of Manifolds " . ... 27 April - 3 May 2003 . International conference " Kolmogorov and Contemporary Mathematics " in commemoration of the Centennial of Andrei Nikolaevich Kolmogorov New! ... Topology ATLAS: Conferences and Seminars . ...

Еще в разделе: (Показать все результаты (>152) - higeom.math.msu.su/ )

• INVITED ADDRESSES:
• Old conferences (English)
• Taras Panov (English)

... B.V. Somov . head of the department . ... room 80 . ... senior research felow . ... research felow . ... research fellow . ... Our department performes the following most perspective studies: . Special analytical and numerical experimental investigations of the solar plasma involved in the magnetic reconnection process at the Sun. ... Head of the seminar: Prof. B.V. Somov. ... 27 September 2013 The Solar Physics Department was visited by journalists of the leading Russian TV channel "Vesti-1". ...

Еще в разделе: (Показать все результаты (>3) - sun.sai.msu.ru/ )

... Publications . ... Laboratory of Mathematical Methods of Image Processing . Chair of Mathematical Physics . ... Suppression of Musical Noise Artifacts in Audio Noise Reduction by Adaptive 2D Filtering . Publication type . ... Publication date . ... 123rd Audio Engineering Society Convention . ... Title = {Suppression of Musical Noise Artifacts in Audio Noise Reduction by Adaptive 2D Filtering}, . ... BookTitle = {123rd Audio Engineering Society Convention}, . ...

Еще в разделе: (Показать все результаты (>819) - imaging.cmc.msu.ru/ )

... Research Centers . ... Search Faculties Staff . ... About the faculty / Virtual tour / Лекция Д-ра Йошийоки Канеда (Yoshiyuki Kaneda, Japan Agency for Marine-Earth Science and Technology), "Advanced real-time monitoring system and simulation researchers for earthquakes and tsunamis in Japan . Лекция Д-ра Йошийоки Канеда (Yoshiyuki Kaneda, Japan Agency for Marine-Earth Science and Technology), "Advanced real-time monitoring system and simulation researchers for earthquakes and tsunamis in Japan . ...

Еще в разделе: (Показать все результаты (>174) - phys.msu.ru/ )

• Title
• Публикации по истории факультета
• Задачи вступительных экзаменов

... Course "Computer Physics" for 1st and 2nd year students of Physics . ... The audience is 1st and 2nd year students of Physics. ... It consists of a short lecture course, seminars, and a large number of computer labs. ... 1985-1994 : Lectured a specialized course on "Computer Physics"for the 3rd year students of Physics, Department of Physics, and attendees of the continuing education department, International Laser Center of Moscow State University. ... 2016 Quantum Information Laboratory. ...

Еще в разделе: (Показать все результаты (>86) - qilab.phys.msu.ru/ )

LOCAL TSUNAMI WARNING AND MITIGATION ________________________________________________________________________________________________________________________________________ HYDROACOUSTIC ANTENNA : A POWERFUL TOOL TO FORECAST TSUNAMIGENIC EARTHQUAKES Yakov S. Karlik Central Research Institute MORPHYSPRIBOR , 46 Chkalovsky proezd, Sankt-Petersburg, 197378 Russia E-mail: karlik@mail.cl.spb.ru ABSTRACT Hydroacoustic antenna ... 2001). ... Eiby, J.A., 1982: Earthquakes. ...

Еще в разделе: (Показать все результаты (>33) - seac47-2.phys.msu.ru/ )

• LOCAL TSUNAMI WARNING AND MITIGATION -- Official information
• Pre-registration and abstract submission form
• LOCAL TSUNAMI WARNING AND MITIGATION

... Ключевые слова: научно-церковная конференция ""Иисус Христос вчера и сегодня во веки Тот же": Христианство на пороге третьего тысячелетия" (Москва, 23-25 нояб. 1999 г.) ; история Русской Церкви (новейший период) . ... Журнал Московской Патриархии . ... 1 (ЖМП) . ... Ключевые слова: библиография, рецензии . ... Ключевые слова: библиография, рецензии ; библиотеки . ... Ключевые слова: библиография, рецензии ; Церкви Православные: Румынская ; периодика: "Румынская Православная Церковь" (Румыния) . ...

Еще в разделе: (Показать все результаты (>42) - www.srcc.msu.ru/ )

• http://www.srcc.msu.ru/bib_roc/bib/ItemsR29.htm

... Division of General Nuclear Physics MSU . ... INP MSU . ... Faculty of Physics MSU . ... The ANTARES project is the largest project on registration astrophysical neutrino by detection of cherenkov radiation from secondary particles, arising by neutrino interaction with substance of the Earth. ... Since June, 2009 the group of the Lomonosov Moscow State University takes part in the project. ... Our group consists of young researchers of MSU Skobeltsyn Nuclear Physics Institute and Faculty of Physics....

Еще в разделе: (Показать все результаты (>20) - antares.sinp.msu.ru/ )

• ANTARES в МГУ

... Содар . Профилемер . Соник 5 м . ... Профилимер ЗНС . ... Данные . ... Содар Профилемер Соник 5 м Соник 10 м Профилимер ЗНС . ... Если Вас заинтересовали наши данные, ображайтесь к нам . ...

Еще в разделе: (Показать все результаты (>2) - atm007-3.phys.msu.ru/ )

... Russian Pages . CDFE: Home Page . ... Numerical data, graphics, and bibliography . ... description] . Last updated: May 6th, 2014 . ... Last updated: June 15th, 2011 . ... Last updated: . ... Last updated: April 4th, 2015 . ... Last updated: February 25th, 2016 . ... Last updated: September 27th, 2011 . ... Photonuclear Data Index since 1955 . ... Last updated: September 15th, 2015 . ... Last updated: March 22th, 2010 . ... Last updated: March 19th, 2015 . ... Last updated: May 15th, 2002 . ...

Еще в разделе: (Показать все результаты (>43) - cdfe.sinp.msu.ru/ )

• CDFE => Publications
• CDFE => Online Services => Calculator and Graph Engine for Atomic Nuclei
• CDFE => Online services => Chart of Nuclear Quadrupole Deformations

SYSTEMATIC DEVELOPMENT OF NARRATIVE CONNECTED SPEECH IN PRESCHOOL AND EARLY SCHOOL PUPILS THROUGH [STAGE FORMATION OF] STRUCTURED MENTAL ACTIONS Ivanov N.N. Modern Humanitarian Academy, Russia, Moscow, st. Nizegorodskaya, 32, const.4, +7 916 858 15 36, e-mail: nanik-dubna@list.ru Secondary schools currently experience a number of serious problems with large numbers of students who exhibit persistent learning difficulties. One reason for this phenomenon is the under development of coherent speech. ...

Еще в разделе: (Показать все результаты (>13774) - www.mce.biophys.msu.ru/ )

• Books : Search

... It is being organized jointly by the Byurakan Astrophysical Observatory (BAO) and the Armenian Astronomical Society (ArAS). ... LIST OF LECTURERS AND LECTURES : Dr. Vladimir AIRAPETIAN (Goddard Space Flight Center, USA): Physics of Winds from Cool Evolved Stars Dr. Don BARRY (Cornell University ... (observation techniques and theory) Dr. Michel DENNEFELD (Institut d'Astrophysique de Paris, France): Introduction to spectroscopic observations Dr. Serguei DODONOV (Special Astrophysical ...

Еще в разделе: (Показать все результаты (>137) - sai.msu.ru/ )

• European Astronomical Society(EAS): NEWS
• Конференции сайта АстрО. J E N A M - 2 0 0 7
• А С Т Р О К У Р Ь Е Р

Музей Землеведения МГУ . ... Главная страница . ... О Музее . ... Список фианитов Руководство Музея Землеведения Структура Из истории Музея Землеведения МГУ Ученый совет Профком Совет ветеранов . ... Экскурсии по Музею Землеведения МГУ . ... Наука в Музее Землеведения . ... В Музее землеведения МГУ 23 апреля 2016 г. в рамках программы ?Университетская суббота? Программа мероприятий Музея Землеведения МГУ на . ... 9-11 октября 2015 г. Музей Землеведения МГУ // www.museum.msu.ru © 2006-2015 ...

Еще в разделе: (Показать все результаты (>3) - www.mes.msu.ru/ )

• Музей Землеведения МГУ - Контакты
• Музей Землеведения МГУ - О Музее

... Current results . Scientific results . ... Microorganism and fungi . ... The microorganisms catalyze important changes in the biosphere, represent the source of the main atmosphere components and responsible for a significant part of the genetic diversity on our planet. ... That?s why the planned work will be an important factor in solving the fundamental problems in biology of microorganisms, while the results will become the basis for the development of new effective biotechnologies. ...

Еще в разделе: (Показать все результаты (>15) - depository.msu.ru/ )