... News . ... Main activities of the group relate to the nanophotonics and nano-optics of different types of nanostructures including metamaterials. ... Optical tweezers allow the manipulation and measuring the interaction forces of microscopic objects from single living cells to magnetic micro-particles in magnetic fluids. ... Submitted by Маруся_П on Wed, 03/09/2016 - 16:07 . ... Submitted by Маруся_П on Fri, 02/19/2016 - 15:02 . ... Submitted by Маруся_П on Thu, 02/18/2016 - 17:25 . ...

Еще в разделе: (Показать все результаты (>108) - nanolab.phys.msu.ru/ )

• About the laboratory | Laboratory of Nanophotonics & Metamaterials
• About the laboratory | Лаборатория нанооптики и метаматериалов
• Maxim R. Shcherbakov | Laboratory of Nanophotonics & Metamaterials

Yakubovich (i) Professional preparation Olga Yakubovich 1967 ­ 1973 1973 ­ 1978 1996 (ii) Appointments MS in Geochemistry (cum laude), Moscow State University , Russia PhD in Crystallography and Crystal physics, Moscow State University , Russia Dr of Science in Geology and Mineralogy, Moscow State University , Russia 1997 ­ present 1994 ­ 1997 1983 ­ 1994 1973 - 1983 Department of ...

Еще в разделе: (Показать все результаты (>45) - cryst.geol.msu.ru/ )

• http://cryst.geol.msu.ru/en/

... A member of the Russian Academy ofsciences, a great physicochemist,and a world-renowned Professor Boris Vladimirovich Derjaguin died on May scientist, he laid the foundation of the modern science of colloids and surfaces. ... B. V. Derjaguin became known world-wide in scientific circles for his work on the stability of colloids and thin films of liquids which is now known as the DLVO theory, after the initials of its authors: Derjaguin, Landau, Verwey, and Overbeek. ...

Еще в разделе: (Показать все результаты (>46) - nanofluidics.phys.msu.ru/ )

... It is being organized jointly by the Byurakan Astrophysical Observatory (BAO) and the Armenian Astronomical Society (ArAS). ... LIST OF LECTURERS AND LECTURES : Dr. Vladimir AIRAPETIAN (Goddard Space Flight Center, USA): Physics of Winds from Cool Evolved Stars Dr. Don BARRY (Cornell University ... (observation techniques and theory) Dr. Michel DENNEFELD (Institut d'Astrophysique de Paris, France): Introduction to spectroscopic observations Dr. Serguei DODONOV (Special Astrophysical ...

Еще в разделе: (Показать все результаты (>115) - sai.msu.ru/ )

• International School "Frontiers in Numerical Gravitational Astrophysics"
• GCVS Research Group: History and Persons.

... Awards and Prizes . ... Home Research Awards and Prizes . Scholarships of Lomonosov Moscow State University for PhD students and young scientists: . Alexey L. Voskov . ... Awards ofљXIX International Conference on Chemical Thermodynamics in Russia RCCT?2013 (5 of 16): . ... Ilya Pentin, Alexey Voskov (2005) . ... Awards of Moscow government in 2005: . ... Colloquium on 24.12.12 20 Dec 2012 . ... Laboratory of Chemical Thermodynamics . ... 2000-2016 Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>93) - td.chem.msu.ru/ )

• Laboratory of Chemical Thermodynamics
• Colloquium on 18.05.09 Laboratory of Chemical Thermodynamics
• Colloquium on 05.11.09 Laboratory of Chemical Thermodynamics

... The topic is "Define Europe - Different Sculptors, one Shape". ... We already could win the following amazing speakers : - Prof . Dominique Demougin (Professor of Microeconomics at the European Business School) - Prof . Andreas Rasche (Advisor to the UN in terms of Business and Society ) - Phillip Hersel (Member of the Board of ATTAC and head of the blue21 group) - Janis Birks (Mayor of Riga ) - Prof . Horst PЖttker (journalist focused on Eastern Europe teaching at the Uni Dortmund) ...

Еще в разделе: (Показать все результаты (>356) - www.mgubs.ru/ )

• http://www.mgubs.ru/images/Image/IFP%202011%20brochure.pdf
• http://www.mgubs.ru/images/Image/Courses%20overview.pdf
• International Festival and Fair

... INTERNATIONAL TOPOLOGICAL CONFERENCE DEDICATED TO P.S.ALEXANDROFF'S 100TH BIRTHDAY (Moscow, May 27-31, 1996) . MAILING ADDRESS: Department of General Topology and Geometry . ... Moscow State University . Vorobyovy Gory, Moscow 119899 . ... PHONE: +7 095 9394402 . FAX: +7 095 9392090 (attn: V.V.Fedorchuk) . ... We refer those who would like to know more about current events in Topology around the World, to: . TOPOLOGY ATLAS . TOPOLOGY E-PRINTS . ...

Еще в разделе: (Показать все результаты (>130) - new.math.msu.su/ )

• Международная культурная и научная конференция по механике
• Andrei Vladimirovich Fursikov | Department: General Problems of Control.
• Scientific fields of research of the Department of Theory of Plasticity

ANNOTATION on the research of Anna.V. Zatseva (Shishlova), Ph.D. student (on the second year of the program) Research title: Formation and physicochemical properties investigation of ordered metal nanostructures on the surface of polymer films. ... Optical properties of the system: semiconductor (dielectric) substrate - polymer film - ordered ensemble of metal nanoparticles embedded in polymer surface layer is being investigated. ... The PS surface is proved to have viscoelastic properties. ...

Еще в разделе: (Показать все результаты (>131) - www.spm.genebee.msu.ru/ )

• Список сообщений на конференциях
• Image formation and processing methods
• Bagrov Dmitry

Institute of Theoretical Geophysics . ... Consortium for Electromagnetic Modeling and Inversion (University of Utah) . SJ Geophysics Ltd . INFOMINE / Geomine - Geological Exploration and Technology (Links collection) . ... Zonge Engineering: Geophysical Modeling . CEMI software developed at the Center for Electromagnetic Modeling and Inversion (University of Utah). ... AGI Res3Dinv - 3D Resistivity Inversion Software . RINVERT - Resistivity Models and Modeling (or Modelling) Software . ...

Еще в разделе: (Показать все результаты (>87) - geophys.geol.msu.ru/ )

• Page 2
• Geophysical department at Moscow University
• Anis. Page2

... Especially the chaos suppression and synchronization of chaotic behavior was the main aim of my recent scientific research. ... combine numerical and analytical methods. ... A.Loskutov, A.Dzhanoev Chaos Suppression in separatrix neighborhood. ... A.Loskutov and A.Dzhanoev "General mechanism for suppression of homoclinic chaos" // In: The Book of Abstracts of 12-th International IEEE Workshop Nonlinear Dynamics of Electronic Systems, NDES 2004 ,pp.56--60, Portugal, 9-13 May 2004. ...

Еще в разделе: (Показать все результаты (>77) - chaos.phys.msu.ru/ )

• Staff

... О факультете . ... Лекторий МГУ . ... Новости ФББ . Новости МГУ . ... Лекторий МГУ: 19 апреля, Ольга Александровна Филатова . 2016 . ... Программа секции "Биоинженерия и биоинформатика" . ... Олимпиада ФББ МГУ . ... Факультет биоинженерии и биоинформатики был создан на базе НИИ ФХБ им.А.Н.Белозерского МГУ в 2002 году. ... Факультет биоинженерии и биоинформатики, комната 433. ... 2016 Факультет биоинженерии и биоинформатики . Московского Государственного Университета имени М.В.Ломоносова . ...

Еще в разделе: (Показать все результаты (>3) - www.fbb.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>228) - www.genebee.msu.ru/ )

• The A
• razjivin_dept
• AliGraf - GeneBee Graphical Alignment Help

University Satellites and . Space Science Education . ... A SERIES OF ATLASES ON METHODS OF SPACE IMAGES INTERPRETATION AS A NEW TOOL FOR REMOTE SENSING EDUCATION IN EARTH SCIENCES . ... Special manuals in the form of atlases of satellite images and their interpretation results are within the best tools for support of the geographical and ecological research and thematic mapping. ... Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>6716) - cosmos.msu.ru/ )

• Новости