... Supercomputing Technologies in Science, Education and Industry Almanac Series . ... Octotron: Active Control for Reliable Functioning of Supercomputers . ... Detection of all damage/failure sources which may occur within supercomputer or data center; . ... Key feature of the Octotron system is representing the supercomputer functioning model in the form of expanded multi-graph. ... Research Computing Center (RCC) of Lomonosov Moscow State University . ... Excursions to Supercomputing Center . ...

Еще в разделе: (Показать все результаты (>70) - hpc.msu.ru/ )

• Welcome to HPC.MSU.RU! | Moscow University Supercomputing Center
• Supercomputing Education Project | Moscow University Supercomputing Center
• TOWARDS PETAFLOPS | Moscow University Supercomputing Center

... Practical courses . ... The architecture of data acquisition and control systems systems and laboratory works employs various types of plug-in boards, CAMAC modules, GPIB boards, original connecting cards and virtual generators, breadboard modules, and sound blasters, which are used as generators of analog signals of different shapes and as analog-to-digital converters. ... Pascal and C++ are employed to program the different blocks of data acquisition and control systems systems. ...

Еще в разделе: (Показать все результаты (>38) - ilc.phys.msu.ru/ )

О лаборатории . ... Лаборатория теоретической биофизики . ... The manual to FireFly program clearly explain why and how to use spherical or cartesian functions when working with different basis sets. ... The $D5 group provides further control through the D5, F7, and G9 keywords, which pertain to d, f, and g functions, respectively. ... Quantum chemistry information page ERG Research Group: Лаборатория теоретической биофизики написал (Май 19th, 2015 5:52 пп) . ... 2014 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>25) - erg.biophys.msu.ru/ )

... 2000 September 10 . White Dwarf Stars Cool . ... WFPC2 , HST , NASA . Explanation: Diminutive by stellar standards , white dwarf stars are also intensely hot ... but they are cooling. ... Here, researchers have discovered a large concentration of white dwarf stars (circled above). ... Studying how these stars cool could lead to a better understanding of their ages, of the age of their parent globular cluster , and even the age of our universe . ... About APOD | ... NASA Technical Rep.: ...

Еще в разделе: (Показать все результаты (>10) - www.arcetri.astro.it/ )

... id #527 . Journal of Biological Standardization [not defined] . Common information . ... no information] . ... since 1900-01-01 till today . ... http://www.sciencedirect.com/science/.. ... 1973-01-01 . 1989-12-31 . ...

Еще в разделе: (Показать все результаты (>187) - journals.genebee.msu.ru/ )

... It brought about the necessity for finding new methods of teaching literature to students of modern languages and new ways of forming their philological competence and developing their philological background knowledge. Key words: linguistic education, imaginative literature, philological competence, philological background knowledge, federal standards in linguistic education. ... 2004. ... 1999; Kukurian I. An Outline of English Literature (Against British Historical and Cultural Background). ...

Еще в разделе: (Показать все результаты (>51) - ffl.msu.ru/ )

• About Us

... Expanding and Retaining Customer Loyalty with Stefan Legner of InterNetX . Legner started with a brief history of InterNetX, a Regensburg, Germany based hosting and domain registrar provider that has more than 19,500 customers worldwide.He emphasized the need for companies to build long term partnerships, adding that business has always been about the relationship between people rather than companies .Where possible, Legner said that companies should provide an ... cheap the north face . ...

Еще в разделе: (Показать все результаты (>69) - elana.sinp.msu.ru/ )

• cheap ray bans uk as well as two kinds of noctilionid bats | С Днем Победы!
• I?m much more into talking than listening | С Днем Победы!

ВМиК-Online! ... Студенты . ... Выпускники . Работа . ... Компания HP создает новые возможности для того, чтобы технологии приносили максимальную пользу людям, компаниям, государственным структурам и обществу в целом. ... Бизнес HP в России уже 6 лет подряд показывает результаты лучше рынка ИТ в целом. ... Вакансии компании Hewlett-Packard: . ... Телефон компании HP: +7 (495) 797-35-00. ... МГУ . ... Рейтинг компаний составляется на основе данных Клуба выпускников МГУ . ... 2001 2012 ВМиК Online! ...

Еще в разделе: (Показать все результаты (>7) - www.cmc-online.ru/ )

Image warping as an image enhancement post-processing tool Andrey Krylov, Alexandra Nasonova, Andrey Nasonov Abstract A method to improve the results of image enhancement is proposed. The method is based on pixel grid warping, the main idea is moving pixels in the direction of the nearest image edges. ... In this work we present a new post-processing algorithm for image deblurring with enhancement of edge sharpness. ... The result of image warping is highly dependent on the input edges. ...

Еще в разделе: (Показать все результаты (>121) - imaging.cmc.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2014.ICSP.Krylov_Nasonov.Warping1D.en.pdf
• http://imaging.cs.msu.ru/pub/2012.CISP-BMEI.Chernomorets_Krylov.RetinalQ.en.pdf
• http://imaging.cs.msu.ru/pub/2012.CISP-BMEI.Nasonov_Krylov.TextSR.en.pdf

... Форумы > Разное > Тема . ... Форумы Список тем Новая тема . ... Требуется Web - дизайнер. В крупную компанию для переделки существующего и поддержки нового сайта требуется дизайнер. ... Ответить Цитировать . ... web . Web-дизайнер и web-программист действительно две разных профессии. ... Lie groups and Lie algebras - Calculations on computers, . ... Machinery, Working place, Engineering work, Workspace, . ... Сайт работает с 29.08.2000, Copyright 2000 2011 MMOnline.Ru and MMForce.Net, . ...

Еще в разделе: (Показать все результаты (>131) - www.mmonline.ru/ )

• MMOnline | Форумы | Аспирантура | PhD position in the University of Florida
• MMOnline | Форумы | Аспирантура | Аспирантура в Англии по машинному обучению
• Компания Interface Ltd. содействовала проведению Московской конференции молодых

... B Design and developmentof a new vacuum chamber for the tests of Q-factors in suspension's modes . ... E New SQL free principle of coordinate monitoring of the test mass . F Appendix I . ... The achieved p new resolution 2 10;11cm= Hz was su cient to record Brownian vibration with relative accuracy better than 10% (see details in Appendix I). ... See details in Appendix IV) E. New SQL free principle of coordinate monitoring of the test mass The new concept of quantum measurement | ...

Еще в разделе: (Показать все результаты (>77) - hbar.phys.msu.ru/ )

• http://hbar.phys.msu.ru/hbar/pages/vyat/vyate.html
• http://hbar.phys.msu.ru/gorm/dating/china.pdf
• http://hbar.phys.msu.ru/gorm/dating/ivanov-et-al-sial.pdf

... CpAppro . ... TernAPI program . ... Home Our Developments CpAppro . ... The above equation is a linear combination of thermodynamic functions of the harmonic oscillator (Planck-Einstein functions). This approach is developed as a part of a universal method of approximating temperature dependences of standard thermodynamic properties for crystalline substances. ... Colloquium on 24.12.12 20 Dec 2012 . ... Laboratory of Chemical Thermodynamics . ... 2000-2016 Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>6) - td.chem.msu.ru/ )

... Женский клуб . ... Издательство МГУ . ... МГУ им.Ломоносова . ... Выпускники МГУ . ... Дайв-Клуб МГУ . ... В прошлом году окружение российского президента Путина контролировало важнейшие предприятия с активами на 222 млрд долларов и чистой прибылью 11 млрд долларов. Активы этих государственных компаний составляют почти 40% российского ВВП, сообщает немецкая Frankfurter Allgemeine , освещая проблему "государственной олигархии" в России. ... Что и как контролирует Кремль . ...

Еще в разделе: (Показать все результаты (>33902) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Каждый рабочий день в Канаде погибает пять человек
• Клуб выпускников МГУ: "Скромные банки"
• Клуб выпускников МГУ: Обсуждение материала "Каждый рабочий день в Канаде

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>75) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.

... Aptamer DNA : A New Type of Thrombin Inhibitors V. A. Spiridonova*,1 E. V. Rog**, T. N. Dugina***, S. M. Strukova***, and A. M. Kopylov** *Belozersky Institute of Physicochemical ... State University, Vorob'evy gory, Moscow, 119899 Russia Received November 13, 2002; in final form, November 21, 2002 Abstract--The formation of complexes between various thrombin preparations and 30-mer aptamer DNA was comparatively studied, and a correlation between the ... 5 2003 Vol. ... Vol. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/MolBio6_00KopylovLO.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/nar2004.pdf
• http://rnp-group.genebee.msu.su/pdfs/febsz.pdf

Numerical Codes for Constellations, used in the GCVS for the 88 constellations. The three-letter abbreviations are those adopted by the International Astronomical Union for standard usage, except that they are, of course, all in upper case characters in the GCVS. Code | Const | ... Ant | ... Aps | ... Aqr | ... Aql | ...

Еще в разделе: (Показать все результаты (>55) - sai.msu.ru/ )

... Data . ... Bartels rotation number . ... Field Vector [Degrees (GSE coords)] . ... sigma|B| [RMS Standard Deviation in average magnitude (word 10), nT] . ... Proton temperature [Degrees, K] . ... R [sunspot number] . ... Proton flux [number/cmsq sec sr >1MeV] . Proton flux [number/cmsq sec sr >2MeV] . Proton flux [number/cmsq sec sr >4MeV] . Proton flux [number/cmsq sec sr >10MeV] . Proton flux [number/cmsq sec sr >30MeV] . Proton flux [number/cmsq sec sr >60MeV] . ...

Еще в разделе: (Показать все результаты (>19) - smdc.sinp.msu.ru/ )

• COSRAD model - Space monitoring data center
• Space monitoring data center

... Клуб выпускников / Доска объявлений . клуб выпускников члены клуба вступить в клуб наши партнеры . Поиск работы и вакансии . ... Для участия в разработке информационных систем для гражданской авиации (Linux, C++, Oracle) с возможностью проявить себя требуются программисты C++. ... приветствуется знакомство с Unix/Linux, SQL, любой уровень знания английского . ... премии по результатам работы . место работы - рядом с м. Динамо . ... URL: http://http://www.sirena2000.ru/sirena/about.html . ...

120. SDPpred