... Seminars . ... Group 417 [ PDF ] Students are expected to attend lectures and seminars which is the standard forum for class communication. ... Some of the homework problems might appear on the tests and the exam. ... Your class grade total percentage is given by 40% seminar and homework, 25% first test and 35% second test. ... Students with the class grade 5 and 4 may get a final course grade without a final exam, but only upon the recommendation of seminar assistants. ... Test 1 [ PDF ] . ...

Еще в разделе: (Показать все результаты (>38) - nanofluidics.phys.msu.ru/ )

Analysis of the ANTARES data for SN neutrino detection V. Kulikovskiy (MSU / INFN Genova) Hit counts in the detector. The number of hits ( hit counts ) in a time slice (104.8 ms) is used (this information is stored in each run) Mean number of hit counts in one PMT is ~5500 (corresponds to ~55 kHz) Expected number of hits from SN in 100ms is 11.6 ( 550 0) Bioluminescence bursts should be excluded Bioluminescence cut We have collected distributions of hit counts for each ...

Еще в разделе: (Показать все результаты (>16) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/docs/INFN%20-%20ANTARES.pdf
• http://antares.sinp.msu.ru/docs/acceptance_bamberg2011-1.pdf

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>152) - monkey.belozersky.msu.ru/ )

• SDPpred
• About authors ot this complex
• Example of supporting positions

... id #527 . Journal of Biological Standardization [not defined] . Common information . ... no information] . ... since 1900-01-01 till today . ... http://www.sciencedirect.com/science/.. ... 1973-01-01 . 1989-12-31 . ...

Еще в разделе: (Показать все результаты (>14) - journals.genebee.msu.ru/ )

... 2000 September 10 . White Dwarf Stars Cool . ... WFPC2 , HST , NASA . Explanation: Diminutive by stellar standards , white dwarf stars are also intensely hot ... but they are cooling. ... Here, researchers have discovered a large concentration of white dwarf stars (circled above). ... Studying how these stars cool could lead to a better understanding of their ages, of the age of their parent globular cluster , and even the age of our universe . ... About APOD | ... NASA Technical Rep.: ...

Еще в разделе: (Показать все результаты (>16) - www.arcetri.astro.it/ )

... Ярмарка вакансий и стажировок для студентов и выпускников вузов . ... Вакансии . ... Learning and Understanding HP and 3rd party software solutions, including architectures, development practices, frameworks, methodologies, SDK's, additional programming languages and tools as necessary, etc . ... Development of test plan, unit tests, integration, system and acceptance tests, basing on functional specification and user requirements, architectures, development schedules and project plans . ...

Еще в разделе: (Показать все результаты (>72) - www.physcareer.ru/ )

• Business Operations Analyst (Graduate) / Вакансии / Physcareer.ru
• Software Development Engineer - Student/Intern / Вакансии / Physcareer.ru
• Научная стажировка и постоянная работа в подразделении Telecommunication

... Policies to promote environmentally sound production methods; conservation and protection of natural resources; . ... Farm price policy and reduction of agricultural subsidies; . ... Credit; consumer credit; production credit; credit agencies; . Problems related to extension of short-term production credits; medium-term and long-term credits; investment and credit policies: demand and supply; economics, institutions; agricultural debt restructuring; mortgage systems; . ... Markets and trade; . ...

Еще в разделе: (Показать все результаты (>145) - www.fadr.msu.ru/ )

• An International Consensus on Calcareous Paleosol Classification
• Klumpen—a Mesoscale Level of Classification for Soil Structure: Rationale
• NEW FARM RESOLUTION (From RUSAG conference)

Software on Data Processing . We Offer Statistical Software And . Software On Data Analysis And Processing. ... The package is intended for those, who doesn't have large experience in statistical analysis, but needs a quick and convenient data processing tool. ... Package provides full complex of registration and analysis methods, individual EKG monitor-analyzer, special tools for complete polygraph analysis. price: 700$ - 2200$. phone number (095) 437-3695, 155-1365 . ... InCo . ...

Еще в разделе: (Показать все результаты (>3) - statsoft.msu.ru/ )

• InCo literature in English

... OK ======================================= To compile CompHEP input make command ======================================= make # command output : ****************************************************************** * CompHEP -4.4p3 has been successfully built * * * * Please create a user working directory using the command * * make setup WDIR=path_to_your_user_work_dir * * NOTE: Do not use '~' to refer to home ... CompHEP-interfaces-1.0.1 has been installed successfully!! ...

Еще в разделе: (Показать все результаты (>12) - lhe.sinp.msu.ru/ )

... It brought about the necessity for finding new methods of teaching literature to students of modern languages and new ways of forming their philological competence and developing their philological background knowledge. Key words: linguistic education, imaginative literature, philological competence, philological background knowledge, federal standards in linguistic education. ... 2004. ... 1999; Kukurian I. An Outline of English Literature (Against British Historical and Cultural Background). ...

Еще в разделе: (Показать все результаты (>60) - ffl.msu.ru/ )

• Иностранным гражданам
• About Us

... Expanding and Retaining Customer Loyalty with Stefan Legner of InterNetX . Legner started with a brief history of InterNetX, a Regensburg, Germany based hosting and domain registrar provider that has more than 19,500 customers worldwide.He emphasized the need for companies to build long term partnerships, adding that business has always been about the relationship between people rather than companies .Where possible, Legner said that companies should provide an ... cheap the north face . ...

Еще в разделе: (Показать все результаты (>107) - elana.sinp.msu.ru/ )

• cheap ray bans uk as well as two kinds of noctilionid bats | С Днем Победы!
• editor | С Днем Победы!
• cheap longcham | С Днем Победы!

... TWO USES OF ANCIENT ASTRONOMY . ... Limitations inciude lack of veracity in many records, errors in dating events, and uncertainty in calculating the circumstances of ancient eclipses of the Sun. ... Thus, in this paper, I shall discuss two and only two uses of ancient astronomy. ... This is the same as the time-equivalent precision of a solar eclipse, and hence an Islamic time observation is entitled to the same statistical weight as an observation of a total solar eclipse at a known point. ...

Еще в разделе: (Показать все результаты (>91) - hbar.phys.msu.ru/ )

• Age Determinations by Radiocarbon Content: Checks with Samples of Known Age
• njudge.htm
• R.R.Newton, "Astronomical evidence..."

ВМиК-Online! ... Студенты . ... Выпускники . Работа . ... Компания HP создает новые возможности для того, чтобы технологии приносили максимальную пользу людям, компаниям, государственным структурам и обществу в целом. ... Бизнес HP в России уже 6 лет подряд показывает результаты лучше рынка ИТ в целом. ... Вакансии компании Hewlett-Packard: . ... Телефон компании HP: +7 (495) 797-35-00. ... МГУ . ... Рейтинг компаний составляется на основе данных Клуба выпускников МГУ . ... 2001 2012 ВМиК Online! ...

Еще в разделе: (Показать все результаты (>7) - www.cmc-online.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>160) - www.pereplet.ru/ )

... CpAppro . ... TernAPI program . ... Home Our Developments CpAppro . ... The above equation is a linear combination of thermodynamic functions of the harmonic oscillator (Planck-Einstein functions). This approach is developed as a part of a universal method of approximating temperature dependences of standard thermodynamic properties for crystalline substances. ... Colloquium on 24.12.12 20 Dec 2012 . ... Laboratory of Chemical Thermodynamics . ... 2000-2016 Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>5) - td.chem.msu.ru/ )

... Женский клуб . ... Издательство МГУ . ... МГУ им.Ломоносова . ... Выпускники МГУ . ... Дайв-Клуб МГУ . ... В прошлом году окружение российского президента Путина контролировало важнейшие предприятия с активами на 222 млрд долларов и чистой прибылью 11 млрд долларов. Активы этих государственных компаний составляют почти 40% российского ВВП, сообщает немецкая Frankfurter Allgemeine , освещая проблему "государственной олигархии" в России. ... Что и как контролирует Кремль . ...

Еще в разделе: (Показать все результаты (>33902) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Обсуждение материала "Каждый рабочий день в Канаде
• Клуб выпускников МГУ: Каждый рабочий день в Канаде погибает пять человек
• Клуб выпускников МГУ: Отделите Чечню от России. Откровения молодого рогозинца

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>76) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.

A Dictionary of Units . ... yotta [Y] 1 000 000 000 000 000 000 000 000 = 10^24 zetta [Z] 1 000 000 000 000 000 000 000 = 10^21 exa [E] 1 000 000 000 000 000 000 = 10^18 peta [P] 1 000 000 000 000 000 = 10^15 tera [T] 1 000 000 000 000 = 10^12 giga [G] 1 000 000 ... cubic (+ any units) . ... This unit also has the great advantage of being numerically unchanged for grams/cubic centimetre and tonnes/cubic metre (or megagrams/cubic metre). ...

Еще в разделе: (Показать все результаты (>65) - www.kosmofizika.ru/ )

• Frequently Seen Space/Astronomy Acronyms

Nonlinear Dynamic Phenomena in Physiological Control Systems Mosekilde E. BioSim Coordinator EU Network of Excellence Department of Physics, Technical University of Denmark, Kgs. Lyngby, 2800, Denmark; e-mail: erik.mosekilde@fysik.dtu.dk The purpose of this talk is to demonstrate the essential role that nonlinear dynamic phenomena play in normal physiological regulation and in the development of various diseases. As an example we consider renal auto-regulation in normo- and hypertensive rats. ...

Еще в разделе: (Показать все результаты (>33) - www.msm.biophys.msu.ru/ )

• MSM 2007