... The main goal of the interdisciplinary MCE conferences is organization of the productive interaction between scientists and higher education staff, preservation of traditions of Russian science and education, training of scientific and pedagogical staff in the field of mathematical modeling and information technologies and attraction of young people into science and education. [ read more.. ... Doctor of Biological Sciences, Professor, Moscow State University and Institute of Gene Biology. ...

Еще в разделе: (Показать все результаты (>166) - www.mce.biophys.msu.ru/ )

... Class . ... ClipMap ( ConcreteIndexMap prev, int position, int low, int extent) . Create an IndexMap which clips along a specific dimension and is functionally composed with another IndexMap. ClipMap (int position, int low, int extent) . ... Constructor Detail public ClipMap (int position, int low, int extent) . ... public ClipMap ( ConcreteIndexMap prev, int position, int low, int extent) . ... prev - IndexMap to be composed with this. position - the dimension number to clip along . ...

Еще в разделе: (Показать все результаты (>28) - angel.cs.msu.su/ )

• : Package ucar.multiarray
• : Class FlipMap
• : Class SliceMap

MAKETEXT{"Why am I being asked to confirm?" ... STARTSECTION{ you }%% MAKETEXT { You }%%ENDSECTION{ you }% %STARTSECTION{ ok }%% MAKETEXT { OK }%%ENDSECTION{ ok }% %STARTSECTION{ cancel }%% MAKETEXT { Cancel }%%ENDSECTION{ cancel }% %STARTSECTION{ webserver }%% MAKETEXT { Webserver em running Foswiki /em }%%ENDSECTION{ webserver }% %STARTSECTION{ dialog }%% This topic: System > FAQWhyYouAreAskedToConfirm . ... Ideas, requests, problems regarding Foswiki? ...

Еще в разделе: (Показать все результаты (>5247) - wiki.cmc.msu.ru/ )

• PatternSkinCss < System < Foswiki
• PatternSkinColorSettings < System < Foswiki

Moscow Astronomical Plate Archives: . Contents, Digitization, Current and Possible Applications . ... We describe the astronomical plate archives in Moscow and Zvenigorod and the existing digitization projects. ... 2 The Plate Archive of the Sternberg Institute . The contents of the most important Moscow astronomical plate archive, that of the Sternberg Astronomical Institute, was briefly presented in Shugarov et al. [1] in 1999. ... THE MOSCOW PLATE COLLECTION (STERNBERG INSTITUTE) . ...

Еще в разделе: (Показать все результаты (>43) - www.sai.msu.ru/ )

• Отдел внегалактической астрономии: ГАИШ Extra-galactic astronomy Group Staff
• Отдел внегалактической астрономии: ГАИШ Extra-galactic astronomy Group
• Absolute proper motions of open clusters

... E-mail | ... Fee received until |300,- E | ... Jan 15, 2008 | Fee received until |350,- E | ... Fee received until |400,- E | 200,- E | ... Fee received until |450,- E | ... a copy of the student's identity card should be sent to the Conference | ... Yes | ... September 13, 2008 | ... Accommodation on September 13, 2008 | ... Pre-conference excursion* on September 13,2008 | ... Post-conference excursion* on September 19, 2008 | ... Transfer to Moscow by train on September 19, 2008, 50-70,- E | ...

Еще в разделе: (Показать все результаты (>150) - mgumus.chem.msu.ru/ )

• http://www.mgumus.chem.msu.ru/ihss-14/docs/regstration%20form-ihss14-exhibition.doc
• http://www.mgumus.chem.msu.ru/ihss/pdf/NL_42.pdf
• IHSS-14

... XPS study of fresh and oxidized (Pb,Ge)Te crystal surface. ... The oxidation of (Pb,Ge)Te crystal surfaces at ambient temperature and humidity was studied by means of XPS in time range from minutes to months. ... At one of them donor behaviour is revealed, and the concentration of donor atoms increases at temperatures lower than those of cubic-rhombohedral phase transition. It was found that the oxidation takes place even after few minutes of air exposure. ...

Еще в разделе: (Показать все результаты (>53) - www.inorg.chem.msu.ru/ )

• Inorganic Synthesis Laboratory people
• Inorganic Chemistry Division

... This article caused a most lively interest from the readers, and received more than a hundred responses, which contained various versions of construction methods of the Sri Yantra. ... In this way he revealed a good correspondence between the concentric levels built by him in this relationship of the three Sri Yantra and the orbits of the planets of the solar system (Fig. 10, shows the first two out of three stars examined by him) with a divergence from the real diameters of orbits of about 1.5%. ...

Еще в разделе: (Показать все результаты (>11) - www.protein.bio.msu.ru/ )

... Specialist degree . ... Master degree . ... Master variants . ... About Faculty . ... Mechmath faculty admission resumed its work and is actively preparing for the new reception 2015! ... Read more about Schedule in June . ... The Dean of Mechanics and Mathematics Faculty, the head of the Department of Mathematical and Computer Analysis Methods, professor Vladimir Chubarikov ; . ... Read more about The Open Day . ... 2016 Mechmath admission for internetional students ...

Еще в разделе: (Показать все результаты (>17) - pk.math.msu.ru/ )

• information | Mechmath admission for internetional students
• IX Festival of Science | Mechmath admission for internetional students
• The Open Day | Mechmath admission for internetional students

... Home News BHP meeting . Delegation of the well-known Great Britain тАУ€аAustralian Company BHP Billiton visited Chemistry Department of MSU and specifically the Laboratory of Chemical Thermodynamics on September 14, 2007. ... Colloquium on 24.10.07 . ... Colloquium on 24.12.12 20 Dec 2012 . ... Colloquium on 23.11.12 22 Nov 2012 . ... Colloquium on 19.10.12 15 Oct 2012 . ... Department of Chemistry . ... Laboratory of Chemical Thermodynamics . ... 2000-2016 Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>92) - td.chem.msu.ru/ )

• Colloquium on 10.04.08 Laboratory of Chemical Thermodynamics
• Graduates Laboratory of Chemical Thermodynamics
• Valery A. Lysenko Laboratory of Chemical Thermodynamics

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>140) - www.genebee.msu.ru/ )

• RNA secondary structure prediction
• Biochemistry (Moscow), Vol
• DIMACS Series in Discrete Mathematics and Theoretical Computer Science Volume

... Previous message: [RU-NGI] Different NAGIOS test results from CERN and SINP . Next message: [RU-NGI] Different NAGIOS test results from CERN and SINP . Messages sorted by: [ date ] [ thread ] [ subject ] [ author ] . ... Насколько я знаю, сейчас уже используется только результат nagios из НИИЯФ МГУ, на ЦЕРНовский можно не обращать внимание. ... RU-NGI mailing list > RU-NGI at theory.sinp.msu.ru > http://theory.sinp.msu.ru/mailman/listinfo/ru-ngi > -- Best regards, Valery Mitsyn . ...

Еще в разделе: (Показать все результаты (>741) - theory.sinp.msu.ru/ )

• Interaction of the Higgs doublet with fermions and generation of fermion masses
• тЬО staff:kryukov:info [THEP]

Выпускники 1968 . ... Список выпускников . Этот список мы не контролируем . ... список не полный . ... Список выпускников из зарубежья . ... Web - ...

Еще в разделе: (Показать все результаты (>35) - foroff.phys.msu.ru/ )

• The Faculty System of Education
• Faculty's Tuition Structure
• Key research directions

О факультете . ... История факультета . Награды факультета . ... Руководство факультета . ... Фотографии факультета . ... Правила приема на факультет психологии МГУ . ... Факультет - школе . ... Издания факультета . ... Лекции гостей факультета . ... Is an "only child" special in some way? If children have no brothers and sisters, do they grow up and develop differently? ... In the 1920s and 1930s the child experts used to say, "Being an only child is an illness in itself'. ...

Еще в разделе: (Показать все результаты (>157) - www.psy.msu.ru/ )

• Second Announcement
• The requirements participate in the competition between the papers of students,

Lomonosov project . News . ... Mikhail Lomonosov . Scientific goals . ... Scientific equipment . ... July 8, 2012 . ... May 10, 2012 . The entrance control of cable system of scientific equipment ?Lomonosov? successfully completed. ... Input control tests of scientific equipment ?Lomonosov? devices is held in NIIEM. December 15, 2011 . Preparations for testing the dynamic module of scientific instruments for satellite ?Lomonosov? is finished. November 30, 2011 . ...

Еще в разделе: (Показать все результаты (>26) - lomonosov.sinp.msu.ru/ )

• Personnel | Университетский спутник "Ломоносов"

... On the beginning of March 2015 delegation of CMC MSU staff visited the Graduate School of Information Sciences (GSIS), Tohoku University (Sendai, Japan) for IT Joint Seminar. During the seminar, the reports of both CMC MSU and GSIS scientific research and training activities were presented and the problems of exchange activities in education and research were discussed. View the full image . ... Second CMC MSU тИТ GSIS Tohoku Joint IT Seminar . ... CMC MSU тИТ GSIS Tohoku IT Joint Seminar . ...

Еще в разделе: (Показать все результаты (>172) - en.cs.msu.ru/ )

• Delegation from Tohoku University (Japan) at CMC MSU | CMC MSU
• CMC MSU тИТ GSIS Tohoku IT Joint Seminar
• Delegation from Tohoku University (Japan) at CMC MSU

... Manuscripts are classified in size into the three categories: . ... The most stringent requirements are imposed on manuscripts of the first category. ... Manuscripts of the second category should contain a representation of main results without excessive details in conclusions and proofs. ... Manuscripts should be prepared in electronic form using LaTeX 2.09 (see the instructions for manuscript preparation in electronic form) . ... The manuscript should be signed by its author(s). ...

Еще в разделе: (Показать все результаты (>72) - vestnik.math.msu.su/ )

This page is devoted to information on Supernova 1999br in NGC 4900 . Basic information on this SN, including the last reported brightness, on this Supernova can be found on the main supernova page. ... Note that there is a very bright foreground star (mag about 11.3) located near the position of Supernova 1999br . ... Mag . ... vsnet-chat 1771 ] Host galaxy of SN1999br . ... from [ vsnet-alert 2870 ] SN 1999br in NGC 4900 . ... The host galaxy NGC 4900 has a rather peculiar appearance. ...

Еще в разделе: (Показать все результаты (>148) - www.rochesterastronomy.org/ )

• Supernova 1999aa in NGC 2595
• Nova in M31 2000 3
• Supernova 2000bg in NGC 6240

Please enter the lightcurve file name and period search parameters: . Lightcurve file: . ... Apply the Heliocentric correction and convert all dates to Terrestrial Time (TT)? ... Phase range for plots: -0.5 to 1.0 0.0 to 2.0 0.0 to 1.0 . ... Also, the Heliocentric correction cannot be applied to such lightcurves. ... Two period search methods are currently implemented. ... This period search service is also available at the mirror sites: Mirror 1 , Mirror 2 , Mirror 3 , Mirror 4 . ...

119. Qt Toolkit - QPointArray Class

120. Intelligent Systems :: Staff :: Zhuk Dmitriy