... Change of membranes properties is one of the main principles of the modulation of the nerve cell function. ... In the present work we show that NO influences various neuronal and axonal membrane structures and thus causes different time-scale changes of nerve cell properties. ... We have shown, that exogenous NO firstly activates voltage-dependent K-channels, decreases nerves excitability and then evokes desorption of Ca2+ from the plasma membrane (Ca2+mb). ... 2007 Biophysics dep., ...

Еще в разделе: (Показать все результаты (>88) - www.msm.biophys.msu.ru/ )

Unit I2 Mathematical language 4 Two identities After working through this section, you should be able to: (a) understand and use the Binomial Theorem; (b) understand and use the Geometric Series Identity; (c) understand and use the Polynomial Factorisation Theorem. ... The roots of a p olynomial are also known as its zeros. ... We obtain the first of these equations by comparing the coefficients of xn on the two sides of the equation xn + a n-1 xn -1 + ··· + a1 x + a0 = (x - 1 )(x - 2 ) ··· (x - n ). ...

Еще в разделе: (Показать все результаты (>23) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/section_1.pdf

... 2 Add Strength Training to Your Fitness Program Higher levels of hormones are associated with youthfulness and vitality, and as it is well known that hormone levels decline with age, many people turn to hormone replacement therapy to maintain their levels. ... 982­92), Kraemer and colleagues found that 62-year-old men who engaged in a 12week program of weight lifting exercise for 45 minutes twice a week were able to raise their testosterone levels to those of 30-year-old men. ...

Еще в разделе: (Показать все результаты (>359) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Senior International Fellows Program
• Клуб выпускников МГУ: International Fellows Program
• Клуб выпускников МГУ: Конференция "Бизнес-инкубатор"

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom_2013.pdf

... In vitro, the protein S7 of Thermus thermophilus is able to form complexes with both the minimal 16S rRNA fragment and the intercistronic region of the str operon mRNA from E.coli (Kd = 1.4x10-7 M and 1.1x10-7 M respectively). ... The filter binding assay. ... The most striking result of our study is that thermophilic protein S7 binds strongly to the E.coli S12-S7 intercistronic region of str mRNA in vitro, inspite of the lack of the functionally analogous thermophilic extended region. ...

Еще в разделе: (Показать все результаты (>7) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/MolBio6_00KopylovLO.pdf
• http://rnp-group.genebee.msu.su/pdfs/article_vas_bioelectro.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/nar2004.pdf

Marketing Plan Outline Canada Business Service Centres - CBSCs Last Verified: 2004-11-08 Document No. 4014 Summary A marketing plan is designed to direct company activities towards the satisfaction of customer needs; determine what the customer wants, develop a product/service to meet those needs, get the product/service to the end user and communicate with the customer - at a profit! ... levels, sales volumes? ... What is the consumer acceptance price range for this type of product/service? ...

Еще в разделе: (Показать все результаты (>14) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/english/venturecapital.doc
• Start-Up Company Development :: Управление инновационной политики и организации

... Коснитесь одной паутинки, и дрогнут все остальные. ... Растениям и животным некому писать, за них некому заступиться, кроме нас, людей, которые вместе с ними населяют эту планету, но не являются ее собственниками." Джеральд Дарелл. Cбережем нашу землю | Oни должны жить | Hаши пернатые друзья . ... Что делать, если.. ...

Еще в разделе: (Показать все результаты (>15) - www.ecocoop.ru/ )

... Таня Трубичева, Коля Чеботарев, Сергей Меженный, Андрей Лебедев . ... Слева направо: Паша Зинюков, Булат Мавлюдов, Галя Ивутина (выше), Муся Григорян, Саша Игнатьев. ... Слева направо: 1)Аня Ноздрачева, 2)Дима Китаев, 3)Миша Ноздрачев, 4)Женя Цибиков, 5)Костя Фирсов, 6)Володя Трифонов, 7)Тамара Голубицкая, 8)Таня Михайлина, 9)Саша Игнатьев, 10)Валя Рябинкина, 11)Таня Чеботарева, 12)Оля Гусева, 13)Коля Чеботарев. ... Таня Гужва, Таня Немченко, Даниэль Усиков перед спуском в снежную . ...

Еще в разделе: (Показать все результаты (>13) - optics.sinp.msu.ru/ )

• polist99
• zagedan

Oxygen Analyzers Electrochemical oxygen analyzers are based on electrochemical reduction of O2 at a negatively polarized electrode. This principle lies in the bases of the Clark-type oxygen-sensitive electrode. [pic] pO2 (CLARK) ELECTRODE This electrode is known as "Clark Type" after their inventor, Dr. Leland Clark. The Clark electrode consists of an anode and cathode in contact with an electrolyte solution. ... The Clark (pO2) electrode measures oxygen tension amperometrically. ...

Еще в разделе: (Показать все результаты (>116) - www.enzyme.chem.msu.ru/ )

• Group of microbial biochemistry and biotechnology

... Начало www.99ru.ru Книги о РУСИ Славянская традиция 8265 . ... Искусство . История.Философия . ... Художественные . ... История Всемирная . ... Искусство и культура . ... Другие виды искусства . ... Этнография Фольклор . ... Наследие Востока . ... Введите код товара из каталога. автор Велецкая Н.Н. Символы славянского язычества. руб. ... Велецкая Н.Н. Символы славянского язычества. ... Автор этой книги, отечественный славист с мировым именем - Наталья Николаевна Велецкая, делает такую попытку. ...

Еще в разделе: (Показать все результаты (>20) - www.bukivedi.ru/ )

... Assessment of water quality under changing climate conditions . ... Scope: Climate change coupled with geographically heterogeneous population growth, land use change, increasing urbanization, and changing water use are expected to have major effects on water supply and water quality. ... Climate change effects on streamflow, timing of snowmelt, timing and magnitude of groundwater recharge, ecosystem responses, and impacts of changing land cover and land use are likely to affect water quality. ...

Еще в разделе: (Показать все результаты (>40) - eng.geogr.msu.ru/ )

• Department of Land Hydrology

Welcome to Fourmilab 's calendar converter! ... In the Julian calendar every fourth year is a leap year in which February has 29, not 28 days, but in the Gregorian, years divisible by 100 are not leap years unless they are also divisible by 400. ... The average length of a year is 365.2468 days compared to the actual solar tropical year (time from equinox to equinox) of 365.24219 days, so the calendar accumulates one day of error with respect to the solar year every 216 years. ... Excel serial day: . ...

Еще в разделе: (Показать все результаты (>12) - sbmg.geol.msu.ru/ )

• Europrobe1

... Co-Chair , ICONO/LAT 2013 . Director, Institute of Laser Physics . ... Russia . ... Conference venue . Moscow, Russia . Program overview . Program topics . ... Advance program . ... Visa to entry Russia . ... ICONO/LAT conference is the leading event in the area of quantum electronics, laser physics, and their applications. ... You are greatly welcome to attend the ICONO/LAT 2013 conference in Moscow, Russia. ... International Laser Center, M.V.Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>22) - iconolat13.phys.msu.ru/ )

• Program overview
• Invited speakers
• Guidelines

... Living systems depository "Noah's Ark" . ... About the project . ... The project of the Moscow State University "Noah's Ark" is dedicated to the creation of multi-functional network storage of biological material. ... Creation of temporary prototypes of living systems depository bank for storage and research of the collected material. ... Development of algorithms for the information processes analysis in living systems for receiving, filing and processing of various types of biological data. ...

Еще в разделе: (Показать все результаты (>6) - depository.msu.ru/ )

• Board of directors | depozitariy

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>90) - npidb.belozersky.msu.ru/ )

• Index of /data
• Index of /data/html_scop
• Index of /data/pdb_new

... It was necessary to construct quite a different type of parachute to be light, compact, encased in a parapack and reliable. At first most parachute designers considered it to be hardly possible for a canopy to open in the air without the aid of some special devices, such as an umbrella spokes, compressed air or powder explosive charges. ... Later on a great number of different parachute systems were worked out and introduced by Russian parachute designers Nikolai Lobanov, Igor Glushkov and others. ...

Еще в разделе: (Показать все результаты (>7) - margaret.imec.msu.ru/ )

• Large-Scale Load Stabilization

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>17) - tukachev.flogiston.ru/ )

• Coursera?s Computing for Data Analysis course on R
• Category: Новости

... ЭОС истфака МГУ . ... x25BA; Кафедра исторической информатики . ... Course categories: Кафедра истории средних веков Кафедра исторической информатики Кафедра исторической информатики / Практика использования ДОТ Кафедра истории России до начала XIX века Кафедра новой и новейшей истории стран Европы и Америки Кафедры этнологии Археографическая лаборатория Школа учителей истории . ... Информационные технологии и математические методы в исторических исследованиях и образовании . ... Home ...

Еще в разделе: (Показать все результаты (>4346) - www.hist.msu.ru/ )

• Moscow State University. Faculty of History. Visiting Scholar's Program
• ЭОС истфака МГУ: Course categories
• Электронная образовательная среда исторического факультета МГУ имени

... Brown x26; Mussett The Inaccessible Earth 01 Introduction.pdf . ... Brown x26; Mussett The Inaccessible Earth 02 Chapter.pdf . ...

Еще в разделе: (Показать все результаты (>51) - ocean.phys.msu.ru/ )

• Index of /courses/geo/lectures-addons/
• Index of /courses/geo/lectures-addons-11/
• Index of /courses/geo/lectures-addons/02/

... Ph.D. thesis - "Continuous minimization methods with variable metric' . ... A continuous projection gradient method of second order with variable metric has been proposed, the convergence theorem was proved. ... T.V. Amotchkina, A. S. Antipin, F.P. Vasiliev Regularized continuous minimization method with variable metric for problems with inaccurate input data// Vestnik MGU, S. 15, Comp. ... T.V. Amotchkina, A. S. Antipin, F.P. Vasiliev Continuous second order minimization method with variable metric...

Еще в разделе: (Показать все результаты (>14) - www.srcc.msu.ru/ )

• examples.htm