... Kirk Hatfield . ... J. Hydrol. In Review). Klammler H., K. Hatfield, and M. Annable. ... Newman, M., K. Hatfield, J. Hayworth, P.S.C. Rao, and T. Stauffer. ... Hatfield, K., M. Annable, J. Cho, P.S.C. Rao, and H. Klammler. ... Brooks, M., M. Annable, P.S.C. Rao, K. Hatfield, J. Jawitz, W. Wise, A. Wood, C. Endfield. ... Brooks, M.C., M.D. Annable, P.S.C. Rao, K. Hatfield, J.W. Jawitz, W.R. Wise, A.L. Wood, and C.G. Enfield. ... Hatfield, K., M.D. Annable, S. Kuhn, P.S.C. Rao, and T. Campbell. ...

Еще в разделе: (Показать все результаты (>125) - mgumus.chem.msu.ru/ )

• MGUMUS -- Current projects

PTOLEMY'S FAILINGS . ... The Crime of Claudius Ptolemy. ... Almost as a stocktaking of Ptolemy , the 1970s saw the publication of three monographic writings on his astronomy , viz, O. Neugebauer's authoritative account of the contents of the Almagest in its context of the mathematical side of the rest of ancient astronomy , 1 O. Pedersen's Almagest companion volume designed to guide also the student of Latin astronomy up to the Renaissance, 2 and R. R. Newton's ...

Еще в разделе: (Показать все результаты (>88) - hbar.phys.msu.ru/ )

• The jump of the second derivative of the moon's elongation

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

... Next Routine] [List of Routines] NAME: ADD_HEADER PURPOSE: addition information from FITS-headers MPFS-frames DESCRIPTION: The function computes the total exposure, mean value zenit distance and modified FITS header CALLING SEQUENCE: Result =ADD_HEADER( headers ) CATEGORY: reduction MPFS-data INPUTS: Headers = String array FITS-headers from the MPFS data OUTPUTS: Header = String array containing the header from the FITS file. ... OPTIONAL INPUT KEYWORD PARAMETERS: BEFORE = Keyword string name. ...

Еще в разделе: (Показать все результаты (>47) - sn.sai.msu.ru/ )

... Further processing Only 3N events of «good» runs of previous analysis are selected: 3N triggered events exist in every run Better accordance with MC for rates 150kHz (see elog 548 by Colas) GC triggered events excluded AaFit: -6.5 (Vladimir's presentation explains reason) Zenith angle 20° (in order to look only at events with vertical tracks) After 2008 2009 2010 all fi year year year ltres: -- 0.83107 -- 0.77107 -- 1.04107 - No evidence of possible anisotropy either. ...

Еще в разделе: (Показать все результаты (>23) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/seminar/Gracheva.pdf
• http://antares.sinp.msu.ru/seminar/Kulikovskiy.pdf
• http://antares.sinp.msu.ru/docs/highQC_2011_Bamberg.pdf

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

Psychology in Russia: State of the Art · 2012 AnAlysis of MAss-MediA Affec ted trAnsforMAtions of the dAnger concept Elena V. Lavrova, Lidiya V. Matveeva Lomonosov Moscow State University, Moscow, Russia The article deals with a study of both short-term and long-term influence of massmedia upon a concept of danger (CD). Subjective concepts of danger (CD) were revealed by means of the authors "Assessment of Dangerous Situations" Questionnaire and a new classification of such concepts was developed. ...

Еще в разделе: (Показать все результаты (>136) - www.psy.msu.ru/ )

• http://www.psy.msu.ru/science/psyrussia/2012/bolotova.pdf
• http://www.psy.msu.ru/science/psyrussia/2009/nazarov.pdf
• http://www.psy.msu.ru/science/psyrussia/2009/veraksa.pdf

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

Еще в разделе: (Показать все результаты (>2) - saistud.sai.msu.ru/ )

• Times of minima(maxima) calculator

. Diameter of circular antenna . 576 m . Number of antenna elements . 895 . Size of an element . 11.4 x 2 m . Geometrical area . up to 20000 sq.m . Wavelength range . 1 - 50 cm . Angular resolution . 2 - 400 arcsec . Accuracy of coordinate determination . better than 1 arcsec . Limiting sensitivity (1994): . flux density . 0.500 mJy . brightness temperature . 0.050 mK

Еще в разделе: (Показать все результаты (>10) - www.issp.ac.ru/ )

• Comet Ephemerides
• Institutes of Chernogolovka

Chlorophyll Fluorescence in vivo : A Theory (Part II). ... The model of carbon assimilation V c ( m M C m -3 s -1 ) by phytoplankton is based on light dependence of photosynthesis , which can be described by a coefficient of underwater radiation absorption by photosynthetic pigments of photosystem II in suspension of microalga a PSP (m -1 ) averaged over the spectral range of underwater radiation, where ... According this assumption the photosynthesis rate is equal to: . ...

Еще в разделе: (Показать все результаты (>9) - www.biophys.msu.ru/ )

• Technical Specifications
• Как отмечалось выше, обилие (по Fo) и фотосинтетическая активность

Federation of European Societies on Trace Elements and Minerals PRELIMINARY SCIENTIFIC PROGRAM 09.06.2010 SESSION 1. Trace element and mineral analysis of environmental and biological samples: bulk determination, speciation and quality control. ... 10.06.2010 SESSION 2. ... SYMPOSIUM ORGANIZATION Venue The 4th International Symposium on Trace Elements and Minerals in Medicine and * Biology will take place in the Hotel "Okhtinskaya" (4, Bolsheokhtinsky prospect, 195027 St.Petersburg, Russia). ...

Еще в разделе: (Показать все результаты (>5) - www.fbm.msu.ru/ )

... RELEC Mission: Relativistic ELECtron Precipitation and TLE Study on-board Small Spacecraft . ... Spacecraft mass: 283 kg. ... The Program of RELEC workshop July, 28, 29, Moscow more details.. ...

Еще в разделе: (Показать все результаты (>3) - vernov-relec.sinp.msu.ru/ )

... 6, February, 2015 POLYNUMBERS, NORMS, METRICS, AND POLYINGLES R. R. Aidagulov and M. V. Shamolin UDC 517.925 CONTENTS 1. Vector Spaces and Algebras of 2. Polylinear Functions and Metr 3. ... Groups of coordinate transformations act on functions of vectors (elements of the algebra). ... For bingles, we use a trigonometric function (or, in the case of a pseudo-Euclidean metric, a hyp erb olic function), since the rotation group that changes the value of a bingle is known. ...

Еще в разделе: (Показать все результаты (>40) - shamolin2.imec.msu.ru/ )

• http://shamolin2.imec.msu.ru/art-102.pdf
• Mathematical Reviews
• Заседание 320 (совместное заседание с семинаром механико-математического

... When embedded within a base document, a URL in its absolute form may contain a great deal of information which is already known from the context of that base document's retrieval, including the scheme, network location, and parts of the url-path. ... Introduction This document describes the syntax and semantics for "relative" Uniform Resource Locators (relative URLs): a compact representation of the location of a resource relative to an absolute base URL. ... 3.1) Base URL embedded in the | ...

Еще в разделе: (Показать все результаты (>4) - hea-www.harvard.edu/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc2396.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1945.txt

... The pap er presents a metho d of finding the disp ersion diagrams, and an inequality for the numb er of mo des, linking the numb er of mo des with the top ological prop erties of the system. node H closednode 1 Introduction cell w1 p1 w2 p2 w3 p3 input terminals opennode Consider an infinite periodic set of tubes filled with compressible lossless linear gas (or liquid). ... The tubes are connected with each other by small nodes. ... There can be dead ends (i.e. closed nodes), or open nodes. ...

Еще в разделе: (Показать все результаты (>52) - acoustics.phys.msu.ru/ )

• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/dd01.pdf
• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/craster_shanin02a.pdf
• http://acoustics.phys.msu.su/teachers/gusev_files/rao24-2.pdf

... ПРОВЕДЕНИЕ ЭЛЕМЕНТНОГО АНАЛИЗА ПИТЬЕВОЙ ВОДЫ . ... проведение анализа элементного состава питьевой воды с целью подготовки . ... работы по отбору проб воды, а собственно анализ химического состава этих . ... анализа элементного состава были выбраны следующие пробы воды: . ... Из полученных результатов анализа проб питьевой воды следует, что . ... значительное (более чем на порядок) превышение норм ПДК по алюминию . ... ко 2 классу опасности химических элементов, наличие его в питьевой воде, . ...

Еще в разделе: (Показать все результаты (>9) - www.ecocoop.ru/ )

• http://www.ecocoop.ru/monitor/archive1/messages/133.html

. Laboratory Head: L.K.Gladilin, tel: (+7 495) 939 3568 , fax: (+7 495) 939 3064 , . Сотрудники Лаборатории (LHPR staff) . Web-pages: . L.K.Gladilin , . V.I.Rud , . I.A.Korzhavina , . Information for our Guests . Справка о создании и первом периоде работы лаборатории, подготовленная в 1980 г. Research Activities: . Scientific Information Search Engines : inSPIRE , ScienceResearch , Google Scholar . Scientific Servers : Interactions , AIP , Elements , Scientific . Feedback: Last modified on March 1, 2016.

Еще в разделе: (Показать все результаты (>9) - lhe.sinp.msu.ru/ )