... Current results . Scientific results . ... Human biomaterial . In recent years the emergence of new man-made environmental factors led to adverse (resulting in negative economic and social consequences) changes in the human population structure. This results in significant changes in the population structure, namely the reduction and disappearance of certain groups of the population (carriers of certain genetic, phenotypic, economic and cultural characteristics). ...

Еще в разделе: (Показать все результаты (>2) - depository.msu.ru/ )

• Animals | depozitariy

Лектор - Igor Alabugin, . ...

Еще в разделе: (Показать все результаты (>2) - do.chem.msu.ru/ )

... This presentation is licensed for use under the terms of the Globus Toolkit Public License. ... Setting the Foundation l Strategies for the Globus Toolkit ­ Layered architecture, protocols APIs l Naming conventions ­ Functions, variables, structures, etc. l Installation tree structure ­ Where things get installed l Source tree structure ­ Where things come from March 25, 2002 Globus ToolkitTM Developer Tutorial : Basics 2 ...

Еще в разделе: (Показать все результаты (>44) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/seixas/posterandre.pdf
• http://acat02.sinp.msu.ru/presentations/ivanchenko/iv.pdf
• http://acat02.sinp.msu.ru/presentations/konash/Slides_ACAT2002.doc

... Applications of Molecular Mechanics to Metal Complexes" . ... Molecular mechanics study of the mixed-ligand lanthanide complexes using Gillespie-Kepert model . ... Within MM-GK, the same parameters are applicable to complexes of different coordination numbers/polyhedra. ... Gillespie-Kepert model . ... Using derived computational parameters, we calculated the geometry of 39 lanthanide ion nonaaqua complexes, 6 octaaqua complexes and 18 beta- diketonate and aqua-beta-diketonate complexes. ...

Еще в разделе: (Показать все результаты (>23) - analyt.chem.msu.ru/ )

... Новости лаборатории . ... Romanova N.A., Fritz M.A., Tamm N.B., Troyanov S.I. Synthesis and X-ray structure of C 2 -C 84 (22)(CF 3 ) 6 , Mend. ... 2014) 24 , 78-79 DOI . ... Konarev D.V., Romanova N.A., Panin R.A., Goryunkov A.A., Troyanov S.I., Lyubovskaya R.N. Magnetic coupling and optical properties of the S 6 -dodecakis(trifluoromethyl)fullerene radical anions in the layered salt (PPN + )[C 60 (CF 3 ) 12 .- ... Copyright 2006-2012, Лаборатория термохимии, Московский государственный университет ....

Еще в разделе: (Показать все результаты (>21) - thermolab.chem.msu.ru/ )

... Head of the Department of Emission-line Stars and Galaxies of SAI MSU . ... Structure and kinematics of galaxies . ... Strasburg Database . Hubble Telescope Archive . ... CFHT Archive . ... Chinese evolutionary synthesis Yunnan . Korean evolutionary synthesis Yonsei . Evolutionary synthesis database BaSTI . ... Electronic Journal "New Astronomy" . Electronic Astrophysical Journal . Electronic Astronomical Journal . ... Questions and comments send to Olga Sil'chenko olga@sai.msu.su ...

Еще в разделе: (Показать все результаты (>46) - sn.sai.msu.ru/ )

Slippage on hierarchical superhydrophobic surfaces (theory, simulation) The exceptional wetting properties of superhydrophobic (SH) surfaces [1] have motivated numerous applications in microfluidics. ... Recent experiments have shown that a hierarchical surface with nanoposts lying on the top of microposts does not necessarily lead to an increase in the effective slip length [5]. ... The main goal is to determine, how the effective slip length depends on the number of hierarchy levels. ...

Еще в разделе: (Показать все результаты (>36) - nanofluidics.phys.msu.ru/ )

• http://nanofluidics.phys.msu.ru/paper/prl20091.pdf
• http://nanofluidics.phys.msu.ru/paper/jpcm2011.pdf

... The latter should be taken into account and carefully modeled as a fluid-structure interaction (FSI) problem. A patient- specific FSI analysis is impossible because it predicts only estimated hemodynamic features which are based on assumptions regarding material properties. The objective of this study is to develop a new methodology that assimilates medical imaging data for quantitative hemodynamic data extraction. ...

Еще в разделе: (Показать все результаты (>10) - hit-conf.imec.msu.ru/ )

• http://hit-conf.imec.msu.ru/2012/lectures/index.html

... 11:00-11:30 Break 11:30-12:00 Lecture 3 Prof . Heinz Oberhammer , Institute of Physical and Theoretical Chemistry , University of Tubingen, Germany Structures and Conformations of Disilacyclohexanes 12:00-12:30 Lecture 4 Prof . Ingvar Arnason , University of Iceland, Iceland Energetics and Potentional Energy Surfaces of Disilacyclohexanes 12:30-13:00 Lecture 5 Prof . Igor Godunov, Chemistry Department , MSU , ...

Еще в разделе: (Показать все результаты (>2) - ged.chem.msu.ru/ )

• General Information. 14 European Symposium on Gas Phase Electron Diffraction

Wireshark · · · · · (Win, Mac, Linux) Open Source (http://www.wireshark.org) · · · ( ) · 2 1 · # usermod ­a ­G wireshark user · wireshark root user@host:~$telnet ya.ru 80 Trying 213.180.193.3.. ... MAC 2. MAC IP ARP 3. L4 Interface # 1 2 3 4 Domain # 1 1 Eth Address 00:00:00:00:00:0a 00:00:00:00:00:09 IPv4 Address 10.0.1.2 10.0.1.1 10.0.2.2 10.0.0.3 Flow # 1 2 Src Itf # 1:49153 3:49153 Dst Itf # 4:234 1:432 Protocol TCP UDP Edges 1-2 1-2 .. ...

Еще в разделе: (Показать все результаты (>4) - lvk.cs.msu.su/ )

• http://lvk.cs.msu.su/~bahmurov/course_realtime/papers/balashov_et_al_eucass2011_monitoring.doc
• http://lvk.cs.msu.su/~bahmurov/course_advanced_networks/ITU_OTN_Tutorial.pdf

О лаборатории . ... Лаборатория теоретической биофизики . ... System requirements : python 2 (2.6 and higher), python openbabel library, python numpy library. ... The memgen script makes a bilayer membrane from different phospholipids and other lipid compounds (e.g. cholesterol). ... Biochemistry (Moscow) Supplement Series A: Membrane and Cell Biology, 2011, Vol. ... Нет комментариев " Python membrane generator for MD simulations " . ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>26) - erg.biophys.msu.ru/ )

• gromacs ERG Research Group: Лаборатория теоретической биофизики
• Nanotubes generating script for PyMol ERG Research Group: Лаборатория
• Phase plane explorer ERG Research Group: Лаборатория теоретической биофизики

Теоретическая группа кафедры общей физики . ... Alexander Tonkikh, Andrey Klavsyuk , Nikolay Zakharov, Alexander Saletsky, Peter Werner, SnSi nanocrystals of zinc-blende structure in a Si matrix , Nano Research, Volume 8, Issue 12, pp 3905-3911 (2015). ... Nikolay Kabanov, Alexander Saletsky, Andrey Klavsyuk, Atomic structure of Ir nanowires on Ge(001), в сборнике Book of Abstracts, European Conference on Surface Science (ECOSS 31), место издания Barcelona, Spain, тезисы, с. 554 (2015). ...

Еще в разделе: (Показать все результаты (>34) - genphys.phys.msu.su/ )

• Index of /rus/lab/mol/234/_vti_pvt

МГУ имени М.В.Ломоносова Русская версия . ... Civil service personnel recruitment and development strategies . ... 29 Feb 2016 . ... 15 Apr 2016 . ... Within the framework of the XXIII Lomonosov International Scientific Conference for students , postgraduate students and young scientists the Graduate School of Public Administration Lomonosov Moscow State University is holding a subsection : Civil service personnel recruitment and development strategies, section: State and municipal management. ...

Еще в разделе: (Показать все результаты (>52) - conf.msu.ru/ )

... Полная версия этой страницы: Работа в Германии . Студенческий форум Физфака МГУ > Общий > Работа . ... CAD-FEM requires a Programmer for a 3 months period . ... Required knowledge: . ... The knowledge in C would allow the engineer to use data structures and to handle dynamically allocated memory. ... Basic knowledge of Fortran. ... Basic knowledge of ANSYS Preprocessing and Postprocessing . ... If you can recommend or / and spare a programmer for 3 months, . ...

Еще в разделе: (Показать все результаты (>155) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > НАУЧНО -ИССЛЕДОВАТЕЛЬСКАЯ РАБОТА В SAMSUNG
• Студенческий форум Физфака МГУ > Помогите со статьями
• Студенческий форум Физфака МГУ > PhD position in molecular dynamics,

... Seminar archive . ... The structure of the X-ray sources in the hard spectral state of accreting black-hole binaries has been a subject of intense debate. The paradigm dominant for many years postulated that the accretion disc in the hard state is truncated at some radius >> the innermost stable orbit (ISCO) whereas the disc reaches the ISCO in the soft state. ... On the other hand, there have been numerous claims in recent years that the disc extends to the ISCO in the hard state. ...

Еще в разделе: (Показать все результаты (>10) - master.sai.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/mol_biol_mosk_2006.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

... With the usage of on-land and satellite altimetrical measurements data some gravity map were made, averaged on one degree trapeziums, in reductions Faja, Bouguer, Glenni, which were included in the geological-geophysical international atlases of Atlantic, Indian and Pacific oceans. ... Boldirev S.A., Gajnanov A.G., Stroev P.A. Dencital inhomogeneities in lithosphere and dynamics of development of the North-West part of the Pacific mobile belt. ... Moscow, Nedra edition, 1967. ...

Еще в разделе: (Показать все результаты (>38) - geophys.geol.msu.ru/ )

• TES. Base model
• TES. C-effect
• TES. Visualization

... High Brightness RTM . ... Fig.1a: 70-MeV pulsed race-track microtron . Many applications require compact, inexpensive and efficient source of electron beam in energy range 10-100 MeV. ... Beam is focused by accelerating structure, which acts as RF quadrupole singlet, quadrupole triplets (12) installed at the even orbits return path and by electromagnet quadrupole singlet (9) installed at common axis. ... Fig.1b: 70-MeV RTM Schematic . ... Energy gain: 4.8 MeV / orbit . Orbits: 14 . ...

Еще в разделе: (Показать все результаты (>3) - vserv.sinp.msu.ru/ )

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Re: Web-interface для ICQ без проблем с кодировками. [ re: penartur2 ] . ... Re: Web-interface для ICQ без проблем с кодировками. [ re: M_K ] . ...

Еще в разделе: (Показать все результаты (>466) - www.snto-msu.net/ )

• как скачать сайт? - Public forum of MSU united student networks
• lorien и z80 - Public forum of MSU united student networks
• C++, по указателю разместить в памяти разнотипные данные - Public forum of MSU

... P hysical Review C - Nuclear Physics , изд - во American Physical Society (United States), 2 015, том 92, с . ... Physical Review Letters , изд - во American Physical Society (United States), 2 015, том 114, ? ... United Kingdom), 2015, том 40, ? ... Physical Review B - Condensed Matter and Materials Physics , изд - во American Institute of Physics (United States), 2015, том 91, с . ... Tkalya E . ... Physical Review C - Nuclear Physics , изд - во American Physical Society (United States) , том 88, ...

Еще в разделе: (Показать все результаты (>99) - danp.sinp.msu.ru/ )

• Scattering
• Мультикастерняя модель легких ядер