Course description: . The eighteenth century has often been described as a century of women. As Enlightenment thinkers challenged traditional ideas about the nature of society and government, they also rekindled the debate about woman's place in society. Women themselves contributed to these debates, assuming a prominent public role as salon hostesses and as enthusiastic consumers and producers of print culture. ... Week 1: Women in Enlightenment Philosophy . ... Women and Science . ...

Еще в разделе: (Показать все результаты (>73) - hist.msu.ru/ )

• Moscow State University. Faculty of History. Undergraduate Course Requirements
• The Rural Roads as the Structural Element of the Roman Organization of Land

... 22-Feb-2006 16:09 . ... 2.1M . ... 155K . ... 125K . ... 168K . ... autorun.html . ...

Еще в разделе: (Показать все результаты (>4) - hit-conf.imec.msu.ru/ )

OldFonts' font package . ... The package includes several Russian book font families ('Academy', 'Latin', 'Elizabeth', 'Usual New' et al.) in both PS Type 1 and True Type form and additional files to use these fonts as well as 'Adobe Minion' and 'Palatino Linotype' font families with LaTeX. The package also contains few supplementary fonts. All fonts contain modern Russian characters as well as those used in the 19th century Russian writing. ... T2D encoding files by A.I.Lebedev: T2D . ...

Еще в разделе: (Показать все результаты (>11) - lizard.phys.msu.su/ )

... Surface disturbance and deformat ion are shown in the same scale. Displac the free surface is much smoother as compared bottom deformations: init ial elevat ion has amplitude and spreads over a rather wide area. bottom theory, bottom ement of with the smaller F ­ velocity potential, H ­ depth, ­ vector of bottom deformation, 0 ­ initial elevation a . ... The init ial elevation assumed to be equal to the vertical bottom deformat ion (a); calculated with use of the Laplace smoothing algorithm (b). ...

Еще в разделе: (Показать все результаты (>9) - ocean.phys.msu.ru/ )

P.V.Korolenko, N.N.Fedotov, V.F.Sharkov. Main properties and potential practical applications of M-mode lasers. ... T.I.Arsenyan, P.V.Korolenko, E.A.Kuliagina, N.N.Fedotov. ... T.I.Arsenyan, N.N.Fedotov, L.S.Kornienko, P.V.Korolenko, E.A.Kulyagina, G.V.Petrova Laser beams with helical wavefront dislocations and their applications in the diagnostical and metrological systems. // 5-th International Conference "Industrial Lasers and Laser Applications '95" (Shatura, Moscow reg., ...

Еще в разделе: (Показать все результаты (>4) - optics.sinp.msu.ru/ )

• Название

... Cultural Mediation of National History and Identity . ... Second International Conference in Tampere , Finland . ... This sense of national identity, of history and possible futures, is communicated by cultural and institutional forces and integrated, individually and collectively, into our sense of a common shared nationhood. ... Through a semiological analysis of television texts, it is demonstrated how, by a re-interpretation of Russian history, new cultural and national identities are...

Еще в разделе: (Показать все результаты (>4) - psyberlink.flogiston.ru/ )

e-mail: eksen@mail.ru ) .. , .. , (e-mail: nataliapekhova@gmail.com ) , , , , , , , competency, competences, competencies, sociology of competency, competence-model, assessment and development in HRM, job descriptions, efficiency of professional activity "" , , , " ". The article examines the history of the use of the term "competence" and related terms in sociology, linguistics, pedagogy and practice of human resource management to identify the area of "sociology of competence". ...

Еще в разделе: (Показать все результаты (>6) - vestnik.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/archive/2011/4/04.pdf

The laboratory is engaged in fabricating high-efficiency catalysts and working out theoretical descriptions of kinetics and mechanisms of the processes which takes place in chemical power sources. ... The kinetics of electrooxidation of some simplest organic fuels is investigated, which is of interest for electrochemical generators. ... B.I.Podlovchenko, E.A.Kolyadko, Lu Shigan, Specific Features of Hydrogen Sorption by Pd Dispersed Forms at a-Phase Potentials // J.Electroanal. ...

Еще в разделе: (Показать все результаты (>4) - www.elch.chem.msu.ru/ )

... Parent Directory - IMGP1427.JPG 14-May-2005 13:34 2.6M IMGP1428.JPG 14-May-2005 13:36 2.8M IMGP1429.JPG 14-May-2005 13:36 2.5M IMGP1430.JPG 14-May-2005 13:36 2.8M IMGP1431.JPG 14-May-2005 13:36 3.1M IMGP1432.JPG 14-May-2005 13:36 2.8M IMGP1433.JPG 14-May-2005 13:37 2.9M IMGP1434.JPG 14-May-2005 13:37 2.8M IMGP1435.JPG 14-May-2005 13:37 2.9M IMGP1436.JPG 14-May-2005 13:37 ...

Еще в разделе: (Показать все результаты (>67) - www.enzyme.chem.msu.ru/ )

... L.V. Yashina, V. Leute, V.I. Shtanov, H.M. Schmidtke, V.S. Neudachina. ... Zyubina T.S., Neudachina V.S., Yashina L.V., Shtanov V.I. XPS and ab initio study of the interaction of PbTe with molecular oxygen . ... V.S. Neudachina, T.B. Shatalova, T.S. Zyubina, V.I. Shtanov, L.V. Yashina, M.E. Tamm, S.P. Kobeleva. ... L.V. Yashina, E.V. Tikhonov, V.S. Neudachina, T.S. Zyubina, A.N. Chaika, V.I. Shtanov, S.P. Kobeleva, Yu.A. Dobrovolsky. The oxidation of PbTe(100) surface in dry oxygen. ...

Еще в разделе: (Показать все результаты (>9) - www.inorg.chem.msu.ru/ )

... Форумы > Аспирантура > Тема . Автор темы Alexey Chernov . Форумы Список тем Новая тема . ... Аспирантская вакансия: байесовский анализ в геномике . ... PhD Student Position in Statistics: "Bayesian Methods for Integrated Genomics" (Switzerland) . ... Strong candidates will have the chance to work on this in later stages of their PhD. ... Следующая тема Предыдущая тема . ... Сайт работает с 29.08.2000, Copyright 2000 2011 MMOnline.Ru and MMForce.Net, . ...

Еще в разделе: (Показать все результаты (>18) - www.mmonline.ru/ )

• MMOnline | Форумы | Аспирантура | Аспирантура в Порту, Португалия

Educational Technology & Society 10(3) 2007 ISSN 1436-4522 : .. . ... 1995). . ... Education Technology & Society 9(1) 2006 pp. 422-427. [ .., 1993] . ... Education Technology & Society 5(1) 2002, pp 222-243. ... Brusilovsky P., 1995] Brusilovsky P. Intelligent learning environments for programming: The case for integration and adaptation // In: J. Greer (ed.) Proceedings of AI-ED'95, 7th World Conference on Artificial Intelligence in Education, Washington, DC, 16-19 August 1995, AACE, pp. ...

Еще в разделе: (Показать все результаты (>108) - www.psy.msu.ru/ )

• http://www.psy.msu.ru/science/psyrussia/2009/shmeleva.pdf
• http://www.psy.msu.ru/science/psyrussia/2012/filipieva.pdf
• http://www.psy.msu.ru/science/psyrussia/2009/suprun.pdf

Title Author Key words New approaches to Marxist theory: Analytical Marxism Dobrinskaya D.E. Analytical Marxism, Marxism, Class, Exploitation, Historical Materialism This article presents a general description of school, which occurs in the 80s of XX century classic categories of Marxist theory in modern sci main research topics of key representatives considered. Analytical Marxism scientific as an attempt to reconstruct ence. Methodological features, of this Marxist school are Abstract

Еще в разделе: (Показать все результаты (>14) - www.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/eng/archive/2015/2/08.pdf
• http://www.socio.msu.ru/vestnik/eng/archive/2014/2/03.pdf
• http://www.socio.msu.ru/vestnik/eng/archive/2015/2/13.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/mol_biol_mosk_2006.pdf

... MBA . EXECUTIVE MBA . ... О Школе . ... Бакалавриат Магистратура МВА General MBA MBA-Производственные системы Executive MBA Краткосрочные и Executive Programs Doing Business in Russia . ВШБ МГУ - школе . ... Главная Программы Doing Business in Russia . Study the Russian business with Lomonosov Moscow State University Business School . The Doing Business in Russia was designed for Executive MBA and MBA students from abroad who are interested in the Russian market. ...

Еще в разделе: (Показать все результаты (>15) - www.mgubs.ru/ )

T he student body is the central group of the Faculty of Physics. ... The Faculty offers its students the widest choice of training programmes and majoring opportunities. ... C urrently there are about 40 general courses and over 650 specialized courses delivered covering a wide range of traditional and new areas of physics research. ... F rom the first year students can be trained under two programs physics or astronomy. ... T here is a specific education system in place at the Faculty of Physics. ...

Еще в разделе: (Показать все результаты (>10) - foroff.phys.msu.ru/ )