THE 75th NAME-LIST OF VARIABLE STARS. ... The 75th Name-List consists of two tables. ... the literature, taken from positional catalogues, including USNO A1.0/A2.0 and GSC, or determined by the authors); the range of variability (sometimes the column Min gives, in parentheses, the amplitude of light variation; the symbol ( means that the star , in minimum light, becomes fainter, than the magnitude indicated); and the system of magnitudes used ( P are photographic ...

Еще в разделе: (Показать все результаты (>20) - www.sai.msu.ru/ )

... The year 2012 marks 110 years of the birth of Alexander Luria (1902-1977). To commemorate the life and scientific achievements of this world-renowned psychologist and the founder of the Russian neuropsychology, Lomonosov Moscow State University, in collaboration with The Burdenko Neurosurgery Institute (where the first Russian neuropsychological laboratory was open) are pleased to announce Moscow International Congress. The Congress will be held in Moscow, from 20 to 22 September, 2012. ...

Еще в разделе: (Показать все результаты (>179) - www.psy.msu.ru/ )

• Psychology in Russia. State of the Art. Instructions for Authors

WERE HITTITE KINGS DIVINELY ANOINTED? ... This is the only clear evidence that the gods were thought to be personally responsible for the anointment of Hittite kings. ... I am arguing that anointment with oil was extended to both Hittite priestly kings and certain other categories of Hittite priests, and that the underlying purpose of this act was ritual cleansing. ... Its beginning is preserved in two mutually complementing parallel versions KUB 35.165 Obv. ... the priest, son of the king'. ...

Еще в разделе: (Показать все результаты (>19) - imk.msu.ru/ )

• http://www.imk.msu.ru/Structure/Linguistics/yakubovich/download/sippanti.pdf
• http://www.imk.msu.ru/Structure/Linguistics/yakubovich/download/lydian.pdf
• http://www.imk.msu.ru/Structure/Linguistics/yakubovich/download/luwian.pdf

Microsymposium 38, MS083, 2003 (A4 format) MERCURY: LOCAL VARIATIONS OF THE PHOTOMETRIC RELIEF. ... Because of trajectory and pointing angle constraints the planet could be observed from Mariner 10 only over a small range of phase angles between about 75o and 110o. Therefore the photometric investigations are restricted to measuring the distribution of brightness on the Mercurian disk. ... Raw versions of real-time processing pictures FDS 0000984 and FDS 0000986 were used (images 196 and 202). ...

Еще в разделе: (Показать все результаты (>93) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Bus/Publications/LPSC2001a/LPSC2001a.pdf
• http://selena.sai.msu.ru/Ber/Publications/IcarusCorrectedProof.pdf
• http://selena.sai.msu.ru/Ber/Publications/ilewg4.pdf

... Revision Log Mode: Stop on copy Follow copies Show only adds and deletes View log starting at and back to . ... edit) . ... 5 years . me.dendik . ... Added rule to evade trapping yourself while eating for e4 snake . ... Added "run mostly forward" rule to e2 snake . ... Changed display names in e2, e4 snakes (they were both Example тАж . ... e4 snake now tries to zig-zag . ... Added two smarter snakes: e2 and e4 . ... snakes added . ... Added example empty snake . ... Added example snake . ...

Еще в разделе: (Показать все результаты (>567) - kodomo.cmm.msu.su/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/jbcb_2006.pdf

... REVIEWS Measurement and Physical Content of Quantum Information B. A. Grishanin and V. N. Zadkov Received January 15, 2002 Abstract--Basic quantum information measures involved in the information analysis of quantum systems are considered. ... But today, it has become possible to intentionally vary directly quantum states of elementary quantum systems. ... 9 2002 MEASUREMENT AND PHYSICAL CONTENT OF QUANTUM INFORMATION 935 its information-equivalent copy is at the input and output. ...

Еще в разделе: (Показать все результаты (>80) - qilab.phys.msu.ru/ )

• http://qilab.phys.msu.ru/papers/PRA22309.pdf
• http://qilab.phys.msu.ru/papers/njp9_10_105041.pdf
• http://qilab.phys.msu.ru/papers/JETP-2000-91(5)-en.pdf

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . ... The active sites on the surface of the nanocrystalline metal oxides and specificity of their interactions with nitrogen-containing organic compounds . ... Selected synthesis methods allow to control the composition and content of the resulting materials used modifiers (SiO 2 , Al 2 O 3 , Cr 2 O 3 , Nb 2 O 5 , Au). ... 2008-2014 The Laboratory of chemistry and physics of sensor and semiconductor materials. ...

Еще в разделе: (Показать все результаты (>40) - www.lssm.inorg.chem.msu.ru/ )

May 12, 1998 NOTES from May 9, 1998: The format of the Solar Event Lists was changed to include a standard SEC style header. ... Please send comments and suggestions to sec@sec.noaa.gov # # Missing data: //// # # Edited Events for 1998 May 11 # # Event Begin Max End Obs Q Type Loc/Frq Particulars Reg# #------------------------------------------------------------------------------- 2560 A0146 //// 1225 HOL ... The UT day of the event's begin time is the UT day of the list. ...

Еще в разделе: (Показать все результаты (>10) - dbserv.sinp.msu.ru/ )

• http://dbserv.sinp.msu.ru/RSWI/sun.pdf

... The notion of convergence to zero in a vector space allows one to define convergence to any p oint by using a translation. ... The notion of a converging sequence can b e introduced without any top ology, by the definition of all sequences converging to some p oint. ... 1, then the sequence n xn converges to zero. ... In the case of the Euclidean top ology, where for at least one comp onent the inequality ci > 1/4 holds, the set J (f ) coincides with the whole space and hence the Julia set is empty....

Еще в разделе: (Показать все результаты (>44) - shamolin2.imec.msu.ru/ )

• http://shamolin2.imec.msu.ru/art-165-1.pdf
• http://shamolin2.imec.msu.ru/art-98-1.pdf
• http://shamolin2.imec.msu.ru/art-166-1.pdf

... However, our studies show that Prosilica EC650 has very good p erformance to use as DIMM image detector. ... The sub-directories /opt/dimm/data/out for the output data file, /opt/dimm/data/log for the output log file yymmdd-dimm.log and /opt/dimm/etc for the configuration file must b e created. ... Pictures mode The Pictures mode provides grabbing of the star b ox images and storing their sequence as one output file "b oxrecord.fits" in /opt/dimm/data/images/ sub directory. ...

Еще в разделе: (Показать все результаты (>22) - curl.sai.msu.ru/ )

• http://curl.sai.msu.ru/mass/download/doc/infrasoft_eng.pdf
• http://curl.sai.msu.ru/mass/download/doc/pmt_param_eng.pdf
• http://curl.sai.msu.ru/mass/download/doc/new_details_v2.pdf

... The subjects of the Colloquium-458 cover important problems dealing with the verification of constitutive equations, the organization of experiments, the connection between microstructures and mechanical properties and the effective utilization of the modern FEM packages. ... Institute of Mechanics, Lomonosov Moscow State University, Michurinsky Prospekt, 1, 117192, Moscow, Russia . ... S.-Petersburg, 195251, Russia. ... Institute for Problems in Mechanics of Russian Academy of Sciences . ...

Еще в разделе: (Показать все результаты (>4) - www.imec.msu.ru/ )

• Институт механики МГУ
• EUROMECH Colloquium-458

... Run source ./setup.csh 6. ... When you will start to work next time, run setups in following order : cd /data1/atlas/work source ../software/12.0.8/setup.csh cd testarea/12.0.8/ source $ATLAS_ROOT/../work/cmthome/setup.csh -tag=12.0.8 To exclude first two lines, just add to your .login these lines : # add Atlas env-s : source /data1/atlas/software/12.0.8/setup.csh After that next time just do : source $ATLAS_ROOT/../work/cmthome/setup.csh -tag=12.0.8 cd /data1/atlas/work/testarea/12.0.8/ . ...

Еще в разделе: (Показать все результаты (>13) - lhe.sinp.msu.ru/ )

• Brief CompHep Installation Instruction

... We live in the epoch of modern informational, scientific and intellectual technologies. Modern person, especially young one, cannot imagine life without computers, cellular phones and high-speed Internet. ... History has given a lesson - having splendid science, excellent education and highly organized society, having colossal resources, being a great power, we could not cope with the task - to build a prospering and just society. ... It demonstrates the colossal possibilities of modern science. ...

Еще в разделе: (Показать все результаты (>33) - www.rsr-online.ru/ )

Sergey A. Ayvazyan Methods of Econometrics Introduction Dear reader, You have a textbook in your hands on methods of econometrics, one of the three basic disciplines of higher economic learning, along with micro- and macroeconomics. In Russia, unfortunately, the status of econometrics was recognized belatedly: econometrics was introduced into the study programs of economic learning in several leading Russian higher educational institutions only since 1992. ...

Еще в разделе: (Показать все результаты (>24) - www.mse-msu.ru/ )

• http://www.mse-msu.ru/files/k1205.pdf
• http://www.mse-msu.ru/IV_GMM_Program%20Peracchi.pdf

... Larin A.V, Rybakov A.A., Zhidomirov G.M. Journal of Physical Chemistry C, 116, 2399-2410 (2012). ... Larin A.V, Rybakov A.A., Zhidomirov G.M., Mace A., Laaksonen A., Vercauteren D.P. Journal of Catalysis, 281, 212-221 (2011). ... A.A. Rybakov, A.V. Larin, G.M. Zhidomirov, D.N. Trubnikov, D.P. Vercauteren . ... A. A. Rybakov, E. D. Belega, and D. N. Trubnikov . Journal of Chemical Physics, 133, 144101 (2010) . ... The following article may be found on the site of Journal of Chemical Physics.) ...

Еще в разделе: (Показать все результаты (>21) - beams.chem.msu.ru/ )

... DOI љ] . ... Surface Science 606 , 3-4 (2012), 394?400. ... Soldatov, E., Kislov, V., Gubin, S., Artemyev, M., Kisiel, D., Sergeev-Cherenkov, A., Pavlov, S., Trifonov, A., and Khomutov, G. Monomolecular polymeric films with incorporated au-101 clusters.љ ... Surface Science 532 (2003), 287?293. ... Obydenov, A., Gubin, S., Khanin, V., Polyakov, S., Sergeyev-Cherenkov, A., Soldatov, E., Trifonov, A., and Khomutov, G. Structure and properties of langmuir-blodgett films containing cluster molecules.љ ...

Еще в разделе: (Показать все результаты (>25) - cryolab.phys.msu.ru/ )

• Denis E. Presnov
• Vladislav V. Shorokhov
• Vladimir A. Krupenin

... The optimal control, which led oscillatory system to a certain energy level from any initial conditions at minimum time, is found. ... A set of points where the trajectory becomes an arc of a circle with the other center is called the switching line. ... For drawing switching line near the origin (see for example Figure 3) we note from the system (1) that time is proportional to the sum of the angles 214 this sums for optimal and quasi-optimal processes. ... The control function (14) is not optimal....

Еще в разделе: (Показать все результаты (>12) - belyakov.imec.msu.ru/ )

• http://belyakov.imec.msu.ru/papers/HulaHoopSlides2011.pdf
• http://belyakov.imec.msu.ru/papers/Belyakov_eng.pdf
• Anton O. Belyakov

... Multi-threaded search engines . ... Unfortunately, most documents on search engines I saw in the Internet were either lists of hyperlinks without any comments, or discussions about how many documents are in the database of ... (here is the name of a search engine) and what method of counting of the number of documents was used. No words about the efficiency, i.e. how many documents on some subject I can find using this search engine, especially in comparison with the other ones. ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )