. Laboratory Head: L.K.Gladilin, tel: (+7 495) 939 3568 , fax: (+7 495) 939 3064 , . Сотрудники Лаборатории (LHPR staff) . Web-pages: . L.K.Gladilin , . V.I.Rud , . I.A.Korzhavina , . Information for our Guests . Справка о создании и первом периоде работы лаборатории, подготовленная в 1980 г. Research Activities: . Scientific Information Search Engines : inSPIRE , ScienceResearch , Google Scholar . Scientific Servers : Interactions , AIP , Elements , Scientific . Feedback: Last modified on March 1, 2016.

Еще в разделе: (Показать все результаты (>12) - lhe.sinp.msu.ru/ )

Annu. ... Key Words stellar energy production, Nobel Prize, supernova, binary pairs s Abstract Astrophysics has been an important part of my personal and scientific life three times. ... Gamov suggested to one of his graduate students, Charles Critchfield, that he actually calculate the proton-proton reaction. ... In stars, the proton-proton reaction is usually followed by a chain of reactions with the end result of producing 4He. ... In 1938, they suggested energy production in stars. ...

Еще в разделе: (Показать все результаты (>140) - astro.uni-altai.ru/ )

ORF ALEA CENTER FOR GL OB AL INTERNA TIONAL S TUDIES UNIVERSIT Y OF C ALIFORNIA, SANT A BARBAR A THE ROLE OF RELIGION IN GLOBAL CIVIL SOCIETY: THE MOSCOW WORKSHOP Lomonosov Moscow State University Moscow , Russia June 19, 2013 Sponsored by the Henry R. Luce Initiative on Religion and International Affairs Luce Moscow Workshop The Moscow workshop for the Or falea Center 's Luce Project on religion in ... Moscow State University has its own church of the Saint Tatiana. ...

Еще в разделе: (Показать все результаты (>52) - fgp.msu.ru/ )

• http://www.msu.ru/en/admissions/general-programs/docs/FACULTY%20OF%20GLOBAL%20STUDIES.pdf

... Географии мирового хозяйства . Геохимии ландшафтов и географии почв . Гидрологии суши . ... Рекреационной географии и туризма . Социально-экономической географии зарубежных стран . Физической географии и ландшафтоведения . ... Выберите кафедру . ... Ученый совет . ... Кафедры . ... География" . ... Образование . ... Научно-методический совет по экологии Министерства образования и науки РФ . ... Кафедра гидрологии . ... Просмотров: 176 Тема: pslnl в форуме: Кафедра гидрологии . ...

Еще в разделе: (Показать все результаты (>239) - www.geogr.msu.ru/ )

• aiyuh
• Instructions for Authors, contributing to “GEOGRAPHY, ENVIRONMENT,
• ФОТОКОНКУРС 'ОБЪЕКТИВНАЯ ГЕОГРАФИЯ 2011'. ИТОГИ

... Полная версия этой страницы: Каррент мьюзик . Студенческий форум Физфака МГУ > Общий > ТРЕП > Карренты . ... True andЪ EvilЪ . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: http://www.webwarper.net/ww/~av/forum.dubi...hp?showforum=42 ] . ... 11.12.2005, 12:31 . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: http://www.webwarper.net/ww/~av/forum.dubi...dex.php?act=idx ] . ...

Еще в разделе: (Показать все результаты (>730) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > Программирование
• Студенческий форум Физфака МГУ > Практикум по ЭВМ
• Студенческий форум Физфака МГУ > ZFC IS INCONSISTENT.

... Gas evolution from Brazilian rock crystal and quartz as raw materials for producing silica glass . ... Gas content, along with the content of element impurities and the content of mineral inclusions, is one of the most important characteristics of quality for quartz raw materials in producing high-quality silica glass. Gas evolution from rock crystal and vein quartz from Brazil as quartz raw materials for producing high-quality silica glass has been studied. ...

Еще в разделе: (Показать все результаты (>20) - www.kge.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/batmas30.pdf

html head title Перемещение слоя в режиме drag /title script language= javaScript !-- var app; var szx = 0 ; var szy = 0 ; function start_drag () { app = document.applets.red; app.open_change_mode(0); rc = app.set_current_layer(' show '); if( rc==-1 ) {alert( Нет указанного слоя show ); return ;} app.set_ drag _layer( show ); drag (); ...

Еще в разделе: (Показать все результаты (>27) - adept.srcc.msu.ru/ )

• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/drag/drag2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch1text1.htm

... Natalia Kireeva graduated from the department of biochemistry and worked in different laboratories in Moscow and the USA. ... Maria Sudnitsyna graduated from Moscow State University in 2004, and during the next two years, she investigated the mechanisms of the function of mitochondrial Complex I. Then, she continued her work in a biotechnological firm, and in 2008, she returned to Moscow State University and started her work at the Department of Biochemistry in the group of Prof. N.B. Gusev. ...

Еще в разделе: (Показать все результаты (>70) - biochem.bio.msu.ru/ )

• Upstream open reading frames regulate translation of the long isoform of SLAMF1
• Structure and properties of chimeric small heat shock proteins containing
• Cardioprotective effect of histidine-containing dipeptides in pharmacological

Magnetism Department MSU . ... Magnetism department . ... Magnetic Laboratory was created in Moscow State University by professor Vladimir Arkad ev. ... In 1918 Arkad ev returned in MSU where he founded Moscow Magnetic Laboratory, which exists for a long time on the enthusiasm of their members. ... As the head of new department professor Nikolay Akulov was assigned. ... During the period since 1954 till 1987 the head of magnetism division was Eugeny Kondorsky. ... Lomonosov MSU . ...

Еще в разделе: (Показать все результаты (>12) - magn.phys.msu.ru/ )

... Rapid developments of lasers and particle accelerators resulted in implementation of laser plasma X-ray sources and free electron lasers for various experiments requiring high intensity, shrt duration and monochromatic X-ray radiation. ... BASICS AND APPROACH Thirty years development of laboratory X-ray lasers allowed to reach ~0.1 keV photon energy of coherent X-ray beams in a repetitive mode. ... X-rays originate from Thomson scattering of counter propagating laser and electron beams. ...

Еще в разделе: (Показать все результаты (>5) - miles.sinp.msu.ru/ )

PHYSICAL REVIEW D 69, 102003 2004 Sensitivity limitations in optical speed meter topology of gravitational-wave antennas S. L. Danilishin* Department of Physics, Moscow State University, Moscow 119992, Russia Received 8 December 2003; published 27 May 2004 The possible design of a quantum nondemolition gravitational-wave detector based on the speed meter principle is considered with respect to optical losses. ... As for the speed meter, the light path in this scheme differs from the previous one. ...

Еще в разделе: (Показать все результаты (>84) - hbar.phys.msu.ru/ )

• The jump of the second derivative of the moon's elongation
• Historical Eclipses
• Dionysius Petavius

Ionization Dynamics of Atoms Exposed to Strong Laser Pulses: Semi­Analytical Model at Low Field Frequencies Yu.V. Popov Skobeltsyn Institute of Nuclear Physics, Lomonosov Moscow State University Collaboration B. Piraux, A. Hamido. ... INTRODUCTION AND MOTIVATIONS Keldysh has introduced the adiabaticity parameter = (2Ip)1/2/E where is the laser field frequency, E, the field amplitude, and Ip the ionization potential of the atom. ... Both of them, multiphoton processes and tunnel ionization play a role. ...

Еще в разделе: (Показать все результаты (>6) - lmmqsp.sinp.msu.ru/ )

• Laboratory of Mathematical Models of Quantum Scattering Processes / MSU

... High Brightness RTM . ... Fig.1a: 70-MeV pulsed race-track microtron . Many applications require compact, inexpensive and efficient source of electron beam in energy range 10-100 MeV. ... Beam is focused by accelerating structure, which acts as RF quadrupole singlet, quadrupole triplets (12) installed at the even orbits return path and by electromagnet quadrupole singlet (9) installed at common axis. ... Fig.1b: 70-MeV RTM Schematic . ... Energy gain: 4.8 MeV / orbit . Orbits: 14 . ...

Еще в разделе: (Показать все результаты (>2) - vserv.sinp.msu.ru/ )

... Modeling of Temperature Field in Tissue Created by Therapeutic Phased Arrays with Regular and Random Distribution of Elements . ... Numerical algorithms for modeling of arbitrary three-dimensional acoustic and temperature fields in biological tissue are developed. Spatial distributions of acoustic intensity and temperature patterns in tissues created by two-dimensional therapeutic phased arrays with regular or random distribution of circular elements on a spherical shell are investigated. ...

Еще в разделе: (Показать все результаты (>228) - acs366.phys.msu.su/ )

• Abstract (Invited)

include stdio.h #include math.h double fdet ( float d, float c, int n ); int fau ( float d, float c, int n, double ua[] ); void fld ( float d, float c, int n, double ld[] ); void fv ( int n, double vld [] ); void main() { int i, i1, j, j1, n = 5 ; float d = 2., c = 1., det ; double ld[ 10 ], ua[100], vld [100]; ...

Еще в разделе: (Показать все результаты (>597) - num-anal.srcc.msu.ru/ )

• http://num-anal.srcc.msu.su/eng_math/redict/3.htm
• http://num-anal.srcc.msu.su/eng_math/redict/6.htm
• http://num-anal.srcc.msu.su/meth_mat/prac_alg/arfil/symfor1.txt

... 1 : -1); } function global_depth($f) { $flds = _read('folders.dat'); if ($f == '') return 0; $j = $f; $d = 0; while ($flds[$j]['parent'] != '') { $j = $flds[$j]['parent']; $d++; } return $d + 1; } function fext($url) { return strtolower(substr($url, strrpos($url, '.')+1)); } function global_drawfile($id) // { global $lang; $dscs = _read('files.dat'); // global $lang; if (isset($dscs[$id])) { $s = ' . ... lang=='en'?date('Y/m/d h:i A', $dscs[$id]['time']):date('d.m.Y H:i', $dscs[$id]['time'])).' ...

138. http://www.fbm.msu.ru/sci/sno/conf/russia/IV%20FESTEM%20Symposium.pdf

139. http://www.psy.msu.ru/science/psyrussia/2013/veraksa.pdf

140. http://ccoe.msu.ru/sites/default/files/presentations/MSU-Lecture-CUDA-Intro-2012.pdf