... education . research . ... Lectures Online . ... Fundamentals of Nanotechnology . ... Molecular physiology . ... The lectures were delivered on Mondays, 5 p.m., 01 lecture hall, the Main Building of MSU. The head of the course is Professor M. Ostrovsky, Full Member of RAS, Head of the Chair of Molecular Physiology, Head of the Laboratory of Emanuel Institute of Biochemical Physics, RAS, President of Pavlov Physiology Society. ... Prof. M. Ostrovsky, Full Member of RAS) . ...

Еще в разделе: (Показать все результаты (>34) - nano.msu.ru/ )

• Molecular physiology | Научно-образовательный центр по нанотехнологиям МГУ
• Statute on the Methodical Commissions of the MSU Nanotechnology Education and
• Contact ERC | MSU Nanotechnology Education and Research Center

... Moscow State University: Doctor of Science Degree in Computer Science. ... 1995-present: Educational Course Parallel Computing for students of the Computational Mathematics and Cybernetics Faculty of MSU . 2004-present: Educational Course Parallel Data Processing for students of the Mechanic-mathematical Faculty of South-Ural State University . 1984-1991: practical classes in programming for students of the Computational Mathematics and Cybernetics Faculty of ...

Еще в разделе: (Показать все результаты (>53) - srcc.msu.ru/ )

The Chair of Mathematical Theory of Intelligent Systems and . Laboratory of Problems of Theoretical Cybernetics . ... MaTIS Chair . Staff . ... Email: a dоt v dоt chechkin аt intsys dоt msu dоt ru . ... The Chair of Mathematical Theory of Intelligent Systems, Laboratory of Problems of Theoretical Cybernetics . ...

Еще в разделе: (Показать все результаты (>72) - www.intsys.msu.ru/ )

• Microphone Setup Module
• Training
• Intelligent Systems

... This presentation is licensed for use under the terms of the Globus Toolkit Public License. ... Setting the Foundation l Strategies for the Globus Toolkit ­ Layered architecture, protocols APIs l Naming conventions ­ Functions, variables, structures, etc. l Installation tree structure ­ Where things get installed l Source tree structure ­ Where things come from March 25, 2002 Globus ToolkitTM Developer Tutorial : Basics 2 ...

Еще в разделе: (Показать все результаты (>58) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/GGtut/Dev-08-Information1.pdf
• http://acat02.sinp.msu.ru/presentations/brun/Solutions_2.doc

... Полная версия этой страницы: Каррент мьюзик . Студенческий форум Физфака МГУ > Общий > ТРЕП > Карренты . ... True andЪ EvilЪ . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: http://www.webwarper.net/ww/~av/forum.dubi...hp?showforum=42 ] . ... 11.12.2005, 12:31 . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: http://www.webwarper.net/ww/~av/forum.dubi...dex.php?act=idx ] . ...

Еще в разделе: (Показать все результаты (>766) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > Программирование
• Студенческий форум Физфака МГУ > Предствление Гейзенберга в случае
• Студенческий форум Физфака МГУ > Формула 1

cAMP-induced conformational changes of Protein Kinase A I A-domain O. N. Rogacheva, V. E. Stefanov St. Petersburg State University, Universitetskaya nab. ... In the end, we presented the conformational transition of the A-domain in the form of a partly deterministic sequence of six events: 1) B 2) C1, D1, 3) E, 4) C2[D2], F, 5) G. The sequence of the items of this scheme corresponds to the process of the conformational transition in time. ...

Еще в разделе: (Показать все результаты (>125) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/156.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/83.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/134.pdf

Lomonosov Moscow State University was established in 1755 . ... Full member of the Russian Academy of Science Mathematics Department, Applied Mathematics and Computer Science Section (1997, corresponding member since 1994). Bureau member of the Russian Academy of Science Mathematics Department (1996). Member of the Russian Academy of Science Presidium (1996). Victor Sadovnichy started his working life in 1956 as a loader and timberman at the Komsomolets mine (Gorlovka, Donetsk region). ...

Еще в разделе: (Показать все результаты (>64) - www.msu.ru/ )

• Viktor Ivanovich KRUZHALIN - Pro-Rector
• Mikhail Petrovich KIRPICHNIKOV - Pro-Rector
• Alexander Vasilyevich MIKHALYOV - Pro-Rector

A GENETIC ALGORHYTM FOR OPTIMIZING A NEURAL NETWORK CAPABLE TO LEARN FOR FOOD SEARCHING IN A RADIAL MAZE Budilova E.V., Chepurnova N.E., Chepurnov S.A, Teriokhin A.T. M.V.Lomonosov Moscow State University, Dept. of Biology. ... The upper platform has a hole in the middle and several radially directed tubular canals ("arms") each of which can contain a peace of food and has doors opening only in the centrifugal direction. ... The task of the animal is to visit only those arms which contain food. ...

Еще в разделе: (Показать все результаты (>31) - ecology.genebee.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

... 1967-1972: Undergraduate: M.V. Lomonosov Moscow State University, Department ofТљMechanics and Mathematics. ... 1980-1987: The Deputy Dean for science and research, Department ofТљMechanics and Mathematics, M.V. Lomonosov Moscow State University . ... 1997-2001: The Deputy Minister ofТљthe Education ofТљthe Russian Federation . ... since 2003: Head ofТљDepartment ofТљMechanics, Steklov Mathematical Institute, Russian Academy ofТљSciences . ... Institute of Computer Science Izhevsk, 2005 - 2016 . ...

Еще в разделе: (Показать все результаты (>106) - ics.org.ru/ )

• Institute of Computer Sciences - Staff - Bolsinov Alexey Viktorovich

... 2 · ­ , , · ­ · ­ , 03.12.2015 . ... 14 03.12.2015 · · · 03.12.2015 . ... Verifier Uni ve rsi ty of Te x as 2013 Anteater Uni ve rsi ty of Il l i noi s 2011 FlowChecker Uni ve rsi ty of North Carol i na 2010 VERMONT Network disjoint Port #02 Port #03 h2 h3 s1 Port #01 h1 Port #04 h4 main: disjoint() := Forall[x, out_x, y, out_y: !R(x, out_x) or !R(y, out_y) or x[p] == out_y[p] and out_x[p] == y[p] or x VERMONT proxy CLI Packets are delivered through the control plane We can block them! ...

Еще в разделе: (Показать все результаты (>7) - lvk.cs.msu.su/ )

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>5453) - monkey.belozersky.msu.ru/ )

• SDPpred
• Example of supporting positions
• SCOP famyli: DNA repair glycosylase, 2 C-terminal domains

include stdio.h #include math.h double fdet ( float d, float c, int n ); int fau ( float d, float c, int n, double ua[] ); void fld ( float d, float c, int n, double ld[] ); void fv ( int n, double vld [] ); void main() { int i, i1, j, j1, n = 5 ; float d = 2., c = 1., det ; double ld[ 10 ], ua[100], vld [100]; ...

Еще в разделе: (Показать все результаты (>544) - num-anal.srcc.msu.ru/ )

• http://num-anal.srcc.msu.su/meth_mat/prac_alg/arfil/symfor1.txt
• БЧА НИВЦ МГУ. ZF30R. Решение системы уравнений общего вида
• БЧА НИВЦ МГУ. IA80R_C. Аппроксимация рациональными функциями (равномерная)

... 1 : -1); } function global_depth($f) { $flds = _read('folders.dat'); if ($f == '') return 0; $j = $f; $d = 0; while ($flds[$j]['parent'] != '') { $j = $flds[$j]['parent']; $d++; } return $d + 1; } function fext($url) { return strtolower(substr($url, strrpos($url, '.')+1)); } function global_drawfile($id) // { global $lang; $dscs = _read('files.dat'); // global $lang; if (isset($dscs[$id])) { $s = ' . ... lang=='en'?date('Y/m/d h:i A', $dscs[$id]['time']):date('d.m.Y H:i', $dscs[$id]['time'])).' ...

135. Master program "Mathematical Models of Complex Systems" | Магистерское и

136. http://www.eng.math.msu.su/download/Academic_English_part2.pdf

137. Program committee - ORM 2007

138. Inorganic Chemistry Division

139. Vyach. Vs. Ivanov. Institute of World Culture

140. Etapi- Comments 3/1/97