Embedding formulae for Laplace-Beltrami problems on the sphere with a cut. ... Introduction We are considering the scalar problem of plane wave diffraction by a quarter-plane. ... Applying the BesselSommerfeld technique he has obtained the following formula for the diffraction co efficient: ^ i f ( , 0 ) = e-i g ( , 0, ) d, (1 ) where 0 and are directions of incidence and scattering, is the separation parameter and g is the Green's function of the of the spherical problem. ...

Еще в разделе: (Показать все результаты (>41) - acoustics.phys.msu.ru/ )

• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/embed08.pdf
• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/ursi2.pdf
• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/dd10proc.pdf

The Database of Close Binary Systems . ... Team . ... This web-based interactive database is being developed and maintained by a team at the Sternberg Astronomical Institute of the Moscow State University . The project is an on-line extension of our catalogue on "Highly Evolved Close Binary Stars" (volumes I, II) published by Gordon and Breach in 1996. As of September 2009, the database (both the software and the content) is in its development/testing phase. ...

Еще в разделе: (Показать все результаты (>3) - dionis.sai.msu.ru/ )

... Lomonosov Moscow State Univ Research Center "Computer Science and Control" of RAS (FRC CSC RAS) Operations Research Society (RSORS) will organize the VIII Conference in Octo Operations Research. theoretical aspects and ersity (MSU), Federal and Russian Scientific ber 2016 in Moscow. ... Deadline for abstract submissions is March 31, 2016. ... Conference website: http://io.cs.msu.ru/ORM2016.html. ... Selected extended abstracts will be published in the Conference proceedings. ...

Еще в разделе: (Показать все результаты (>15) - io.cmc.msu.ru/ )

• http://io.cs.msu.ru/ORM2016/ORM2016-2nd_announ-ENG.pdf
• http://io.cs.msu.ru/ILFA2010-4.doc
• http://io.cs.msu.ru/translation2.pdf

... Geography of World Economy . ... Nature Management and Geoecology . ... Research laboratories . ... Geoecology of the Northern Territories . ... Research staff . ... Solomatin, V.I. (Geocryology, Geoecology), Professor, Doctor of Geography . ... Ogorodov, S.A. (Arctic Coastal Dynamics), Doctor of Geography . ... Fedorov, V.M. (Climate Dynamics, Ice Mass Balance), PhD . ... Dynamics of the Russian Arctic Coasts [Dinamika arkticheskix poberezhij Rossii] / Ed. by Solomatin V.I., Sovershaev V.A., 1998. ...

Еще в разделе: (Показать все результаты (>53) - eng.geogr.msu.ru/ )

• Department of Land Hydrology
• Scientific board
• Recreational Geography and Tourism

... When embedded within a base document, a URL in its absolute form may contain a great deal of information which is already known from the context of that base document's retrieval, including the scheme, network location, and parts of the url-path. ... Introduction This document describes the syntax and semantics for "relative" Uniform Resource Locators (relative URLs): a compact representation of the location of a resource relative to an absolute base URL. ... 3.1) Base URL embedded in the | ...

Еще в разделе: (Показать все результаты (>4) - hea-www.harvard.edu/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc2396.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1945.txt

The Department of Talented Youth Affairs and Professional Orientation . ... Moscow State University is actively using various mechanisms for working with talented students , including Universiades, Olympiads and tournaments, scientific conferences and forums, science reading sessions, seminars and debates, research paper competitions, summer and winter science schools (including out-of-campus events), and round tables. ... 2016 - The Department of Talented Youth Affairs and Professional Orientation ...

Еще в разделе: (Показать все результаты (>26) - talant.msu.ru/ )

• Our Graduate Will Represent Lomonosov Moscow State University during the
• All-army olimpiad | The Department of Talented Youth Affairs and Professional
• MSU CNIR visited the Republic of Korea in the delegation of ?Sport

... The linguistic aspects of the model and the properties of the semantic dictionary ensuring the content analysis with compression of the text structure are considered. Our dictionary resources serve an instru- ment for building a multilevel textual semantic structure. ... Reason (A,B), where SemF(A) = SIT or a whole semantic formula; the same for SemF(B). ... Sem(SIT)R . ... Semantic Resources for Textual Content Compression // Fourth International Conference on Meaning-Text Theory (MTT'09). ...

Еще в разделе: (Показать все результаты (>4) - leontyeva.srcc.msu.ru/ )

Sample Submission Form for Example Measurements In order to provide the best and most appropriate measurement/results, the customer is asked to please fill in the following form and enclose it with the sample. This form or equivalent information is required prior to the sample measurements. ... WITec can not provide specialised sample preparation. Measurement Goal: What's the goal of the measurement? ...

Еще в разделе: (Показать все результаты (>18) - nano.msu.ru/ )

• Announcement about the admission to MSU Graduate School for a new Master?s
• Statutes of the MSU Nanotechnology Education and Research Center | MSU

... Master's Programme . ... On-line консультант . ... Master s Programme Enterprise Resource Management System has been developed basing on methodology from SAP, Oracle, Microsoft Companies, as well as the experience of national higher school and international universities. The key objective (mission) of the Programme is to educate professionals in the organization and implementation of projects aimed at deployment and maintenance of ERP systems at domestic enterprises. ...

Еще в разделе: (Показать все результаты (>5) - erp.cmc.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/jbcb_2006.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/batmas30.pdf

... Surface disturbance and deformat ion are shown in the same scale. Displac the free surface is much smoother as compared bottom deformations: init ial elevat ion has amplitude and spreads over a rather wide area. bottom theory, bottom ement of with the smaller F ­ velocity potential, H ­ depth, ­ vector of bottom deformation, 0 ­ initial elevation a . ... The init ial elevation assumed to be equal to the vertical bottom deformat ion (a); calculated with use of the Laplace smoothing algorithm (b). ...

Еще в разделе: (Показать все результаты (>13) - ocean.phys.msu.ru/ )

• [Учеба] КАФЕДРА ФИЗИКИ МОРЯ И ВОД СУШИ

... The following diets will be discussed: . ... michael kors outlet uk . ... 2016 С Днем Победы! ... win 7 ultimate product key Windows 8 key windows 7 key win 7 key windows 7 pro product key win 7 pro product key windows 7 activation key windows 7 ultimate product key windows 7 ultimate serial key windows 7 key online win 7 ultimate key win 7 serial keys Win 7 ultimate key Win 7 ultimate product key windows 7 key sale win 7 ultimate product Key ...

Еще в разделе: (Показать все результаты (>85) - elana.sinp.msu.ru/ )

• longchamp outlet Bikeshed | С Днем Победы!
• cheap michael kors Cyclacel Pharmaceuticals? CYCC CEO Spiro Rombotis on Q2 2015
• editor | С Днем Победы!

... Development of a computer-based information system for Russian folklore studies . Computer systems SKAZKA and SKAZKA-2 are developing by A.V. Rafaeva. The aim of this work is to make program tools for structural analysis of folktale plots and motives. ... 112 – 113; Rafaeva A.V. Analiz rodstvennykh otnoshenij s pomosh’ju sistemy SKAZKA (Analysis of Relate Terms with the Help of SKAZKA Program) // Problemy kompjuternoj lingvistiki: Sbornik nauchnykh trudov, 1. ...

Еще в разделе: (Показать все результаты (>18) - lcl.srcc.msu.ru/ )

... CELL BIOPHYSICS Application of a Photosystem II Model for Analysis of Fluorescence Induction Curves in the 100 ns to 10 s Time Domain after Excitation with a Saturating Light Pulse N. E. Belyaevaa, V. Z. Pashchenkoa, G. Rengerb, G. Yu. ... In the case of weak measuring light, the steady-state level of fluorescence induction curve (Fig. ... The model of PSII predicted that, upon long (10 s) exposure to weak measuring light, the states with open RCs are being populated (Fig. 4, curves 3, 5 QA). ......

Еще в разделе: (Показать все результаты (>38) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/PDF/3345.pdf
• http://library.biophys.msu.ru/PDF/3329.pdf
• http://library.biophys.msu.ru/PDF/3335.pdf

... В 2009 STADIA включена в Государственный стандарт ВПО в качестве одного из трех рекомендуемых к изучению статистических пакетов . ... За 20 лет распространения и совершенствования STADIA стала стандартом de facto для России, она содержит исчерпывающий комплект всех известных методов анализа данных, деловой и научной 2-х и 3-мерной репрезентационной графики, всесторонние возможности импорта/экспорта и преобразования данных, развитую систему экспресс-помощи и совета и многое другое. ... InCo . ...

Еще в разделе: (Показать все результаты (>3) - statsoft.msu.ru/ )

• InCo literature in English

... Head of the Department of Emission-line Stars and Galaxies of SAI MSU . ... Structure and kinematics of galaxies . ... Strasburg Database . Hubble Telescope Archive . ... CFHT Archive . ... Chinese evolutionary synthesis Yunnan . Korean evolutionary synthesis Yonsei . Evolutionary synthesis database BaSTI . ... Electronic Journal "New Astronomy" . Electronic Astrophysical Journal . Electronic Astronomical Journal . ... Questions and comments send to Olga Sil'chenko olga@sai.msu.su ...

Еще в разделе: (Показать все результаты (>48) - sn.sai.msu.ru/ )

• MPFS reduction routines HELP

... О межфакультетских курсах МГУ . Видео МФК . ... Канал МГУ на YouTube . ... Комментарии Дата Просмотры Лайки Комментарии Упорядочить по возрастанию . ... x25BA; Кинофонд МГУ (95) . ... x25BA; Фильмы о МГУ (5) . ... x25BA; СУНЦ МГУ (5) . ... x25BA; МФК (1084) . ... x25BA; Механико-математический факультет (5) . ... x25BA; Социологический факультет (13) . ... x25BA; Факультет журналистики (11) . ... x25BA; Факультет наук о материалах (7) . ... Copyright 2016 ї Видеоархив МГУ имени М.В.Ломоносова . ...

Еще в разделе: (Показать все результаты (>176) - media.msu.ru/ )

• Университетские субботы (МГУ-школе) | Видеоархив МГУ имени М.В.Ломоносова

Welcome to K -corrections calculator, simple service allowing one to determine K -corrections of a galaxy, given its redshift and one or more colours. ... K -correction in choose filter.. ... Redshift . Colour choose colour.. Colour value . Calculator . ... calculate spectral energy distributions , K-corrections calculator , GALEX FUV NUV , UKIDSS YJHK , K-corrections of galaxies , spectral based k-corrections , SDSS filter set K-corrections , K correction code IDL , kcorrect IDL C , . ...

Еще в разделе: (Показать все результаты (>10) - kcor.sai.msu.ru/ )

• K-corrections calculator (version 2010)

Preconcentration Laboratory . Laboratory of Chromatography . ... Laboratory of Kinetics Methods of Anaysis . ... Sorption-spectroscopy methods for determination of organic . ... Room-temperature ionic liquds, computational chemistry . ... New detection methods in ion and ion-pair chromatography . ... For that purpose, methods of selective preconcentration are developed along with the methods of determination of analytes directly in the sensing film or in the permeate after membrane diffusion. ...

Еще в разделе: (Показать все результаты (>35) - analyt.chem.msu.ru/ )

• Conformational Analysis of Boron-Containing Compounds Using Gillespie-Kepert
• Study of amino- and pyridyl-containing zinc(II) and cadmium(II) complexes by

... Veselovsky, V.A., Djanumov D.A. The use of biophysical methods in the study of adaptive reactions of plants, in connection with the problem of resistance. ... Kulaeva, O.N., Mikulovich T.P., Veselova, T.V., Veselovsky, V.A., Kukina, I.M., Klyueva N.Yu. ... Veselovsky, V.A., Veselova T.V . ... Nauka, Moscow (in Russian).1990. 200 p. Veselova T.V., Veselovsky V.A., Chernavsky D.S. Stress of Plant: A Biophysical Approach. ... Veselova T.V., Veselovsky V.A. Photosynthesis and stress of plant cells. ...

Еще в разделе: (Показать все результаты (>8) - biophys.msu.ru/ )

• Photo-induced delayed luminescence