... CLEANSOIL . ... Therefore, the system is applicable to the remediation of soil below buildings, roads, pipelines, railroads, etc, for both local and/or diffuse contamination, and even for preventive applications. to develop and to test an innovative, simple, easy to handle, applicable under existing infrastructures and cost-effective on-site and in-situ soil remediation method able to achieve a degree of soil remediation that allows its reutilisation for different purposes; . ... http://soil.msu.ru ...

Еще в разделе: (Показать все результаты (>14) - eco.soil.msu.ru/ )

ELENA ROVENSKAYA RUSSIAN . ... Optimization and optimal control, dynamic systems, mathematical modeling in economics and ecology . ... Elena Rovenskaya's research aims at the theoretical elaboration of new methods for solving optimal control problems (both analytical and numerical), as well as at application of existing methods to solve economic, social and ecological problems. ... 2009) Rovenskaya E.A. To the Solution of an Optimal Control Problem with State Constraints by Doubled-variations Method. ...

Еще в разделе: (Показать все результаты (>7) - oc.cs.msu.ru/ )

... Ultrastructural changes in the cell center during enterocyte differentiation in the mouse. Tsitologiia. ... Microtubule and intermediate filament patterns around the centrosome in interphase cells. ... The effect of the UV microirradiation of the centrosome on cell behavior. ... A stereoscopic analysis of the centrosome structure in tissue culture cells under the action of carbonyl cyanide p-trifluoromethoxyphenylhydrazone and ouabain Tsitologiia. ... Alieva IB, Vorob'ev IA, Chentsov YuS. ...

Еще в разделе: (Показать все результаты (>29) - cellmotility.genebee.msu.ru/ )

• picture2

... About choir . ... Contacts . Performance the Academic Choir of the Moscow State University in Crocus City Hall . ... Bishop Tikhon opened the choir of Moscow State University in Vienna . Choir of Moscow State University spoke at the Vienna branch of the United Nations . ... Phone: +7 (495) 939-1862,+7 (495) 939-3563 . Post address: . 119234, Moscow, Leninskiyeљgory, 1 . Cultural center MSU,љAcademic choir MSU . ... Address: љLeninskiyeљgory, 1, Cultural center MSU, . ...

Еще в разделе: (Показать все результаты (>2) - new.choir.msu.ru/ )

... Head of the laboratory of Magnetic Semiconductors. ... magnetic semiconductors, spin glasses, chalcogenide spinels, manganites, magnetic two-phase state. ... In antiferromagnetic (AF) semiconductors the ferrons can exist leading off T = 0 and in F semiconductors the ones can present in vicinity of Curie point. ... L.I. Koroleva "Antiferron states of charge carriers in the ferromagnetic semiconductors CuCr2S4-xSex (0.5?x?1.5) with Curie points above room temperature", JETP, 79, No 1, p. 153-162, 1994...

Еще в разделе: (Показать все результаты (>11) - ferro.phys.msu.ru/ )

• Department of General Physics and magneto-ordered matter. Physics Faculty of

... Research . ... 1972 – current: Moscow State University . ... In 1989 she took her doctor's degree in linguistics (kandidat filologicheskikh nauk) at Lomonosov Moscow State University for the thesis "Computer data bases of the Selkup language: creation and use in linguistic research (Mashinnyi fond selkupskogo yazyka: sozdaniye i ispol’zovaniye v konkretnykh lingvisticheskikh issledovaniyakh)”. ... Documentation of and research into endangered languages presupposes linguistic fieldwork . ...

Еще в разделе: (Показать все результаты (>37) - lcl.srcc.msu.ru/ )

arxiv:1307.8241 Кривая вращенияи распределение массы в центре Галактики --- от черной дыры до самых до окраин (Rotation Curve and Mass Distribution in the Galactic Center --- From Black Hole to Entire Galaxy) . Authors: Yoshiaki Sofue . ... Authors: D. Thornton et al. arxiv:1307.2944 Архив экзопланет NASA: Данные и инструменты для экзопланетных исследований (The NASA Exoplanet Archive: Data and Tools for Exoplanet Research) . ... обзор arxiv:1307.0041 Галактическая археология. ...

Еще в разделе: (Показать все результаты (>228) - astro.uni-altai.ru/ )

• Astronomy links

... Animal Welfare Information Center Bulletin [AWIC B] . Common information . ... no information] . ... since 1986-01-01 till today . ... free online journal, formerly known as [Animal Welfare Information Center Newsletter]; aka AWIC Bulletin . ... http://www.nal.usda.gov/awic/newslett.. ... today . ...

Еще в разделе: (Показать все результаты (>49) - journals.genebee.msu.ru/ )

... Electronic journal Issue 4. 10 september 2004 Vorontchuk, Cox III R.W. Developing a Competency-based Career Training and Professional Development Program for Latvia INTRODUCTION. ... With the support of a grant from the NISPAcee a team from the Latvian School of Public Administration, the University of Latvia and the University of Akron (Ohio, USA) prepared for the Chancellery of Latvia a proposal for the creation of a career-long professional development program for those in the civil service. ...

Еще в разделе: (Показать все результаты (>10) - e-journal.spa.msu.ru/ )

• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./bonham_surin.pdf
• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./briedis.pdf

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>15) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

... Individual SELEX products, aptamers, are small molecules (40­100 nt) that have a unique three-dimensional structure, which provides for their specific and high-affinity binding to targets varying from low-molecular-weight ligands to proteins. ... Selection of aptamers binding with a target is the key step in SELEX, as aptamers account for only a small fraction of the initial library (one aptamer per 109 to 1013 molecules) [6]. ... Fourth, modification can increase the aptamer affinity for a target. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/febsz.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

• Roman Sutormin. Home Page

... By $A$ we denote the maximum of the moduli (of the absolute values) of the eigenvalues of this matrix . ... Self-similar solution . ... Адаптивный алгоритм . Adaptive algorithm . ... Additive set function . ... Algebraic random equation . ... Proximity analysis . ... Артикли . ... Multiplying the first relation in (1) by $x$ and the second one by $y$, followed by summation, we come to the concise form of the above equations . ... We try to find a solution to equation (1) which is of the form .. ...

Еще в разделе: (Показать все результаты (>79) - num-anal.srcc.msu.ru/ )

• http://num-anal.srcc.msu.su/list_wrk/ps1/ch4st3.ps
• http://num-anal.srcc.msu.su/list_wrk/ps1/ch4st1.ps
• http://num-anal.srcc.msu.su/eng_math/redict/26.htm

... Advanced chapters of operation research . Algebraic characterization of basic solution of linear program. ... Advanced chapters of Actuarial Mathematics . ... Discounted cash flow analysis and capital budgeting as decision tools are given particular emphasis. ... In the first part of the course we present a modern approach to modeling economic systems. ... The problem of tax optimization under a given financing budget. ... Магистратура: master@cmc.msu.ru, 3-й этаж, комната 360, тел. ...

Еще в разделе: (Показать все результаты (>15) - hcs.cmc.msu.ru/ )

• Mathematical models and methods in VLSI design | Магистерское и послевузовское
• Master Education | Магистерское и послевузовское образование Entrance

... Information for the applicants . ... News . ... The Faculty of Bioengineering and Bioinformatics, Lomonosov Moscow State University was founded in 2002 with the express purpose of training of highly qualified personnel for the universities, research institutes, medical companies and facilities, and pharmaceutical and biotechnology industries. ... Faculty of Bioengineering and Bioinformatics, office 433. ... 2016 Faculty of Bioengineering and Bioinformatics, . Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>10) - en.fbb.msu.ru/ )

• Background? Faculty of Bioengineering and Bioinformatics, MSU

... The traditional answer to this question is unequivocal: тАЬno, public scholarship cannot and should not exist.тАЭ To popularize knowledge is to simplify, and simplification risks the loss of nuance and complexity, the very essence of scholarly knowledge. ... The public sphere can know but a distorted version of scholarly knowledge. ... You need JavaScript enabled to view it. (with Summer School-2016 in the subject line) before April 25, 2016. ... Summer School Archives . ...

Еще в разделе: (Показать все результаты (>5) - discours.philol.msu.ru/ )

• Free verse and free dance

... Alexey D. Neverov . ... Department of Bioengineering and Bioinformatics, Moscow State University. State Scientific Center GosNIIGenetika. ... EDAS human . EDAS mouse . EDAS dog (not availible now) . EDAS rat (not availible now) . To navigate this site please install the latest version of Macromedia Flash Player for Windows or for Linux . If you do not wish to install Flash you could use text pages with less functionality. ...

Еще в разделе: (Показать все результаты (>3) - edas2.bioinf.fbb.msu.ru/ )

• EDAS (human) - Alternative Splicing DataBase.
• EDAS (mouse) - Alternative Splicing DataBase.

body bgcolor="#FFFF95"> <center><b><H2> Cписок работ за период 1979-1980 гг. H2></b></center><br> Шенаврин В.И., <font color="#FF0000">Хрузина Т.С.</font> <font color=green> О переменности блеска R Северной Короны в инфракрасном диапазоне. </font> <font color=blue> // Aстрон. ... 1979, No. <b>1062</b>, 1-3<br> </font> <hr> <font color="#FF0000">Хрузина Т.С.</font> <font color=green> Циклы звездной активности у переменных типа R Северной Короны. </font> <font color=blue> // Астрон.Цирк., ...

Еще в разделе: (Показать все результаты (>20) - uranus.sai.msu.ru/ )

• http://uranus.sai.msu.ru/~kts/said/a1981
• http://uranus.sai.msu.ru/~kts/said/a1982
• http://uranus.sai.msu.ru/~kts/said/a1983

NANOSYSTEMS: PHYSICS, CHEMISTRY, MATHEMATICS, 2014, 5 (1), P. 195­202 USING ARTIFICIAL NEURAL NETWORKS FOR ELABORATION OF FLUORESCENCE BIOSENSORS ON THE BASIS OF NANOPARTICLES S. A. Burikov1 , S. A. Dolenko2 , K. A. Laptinskiy1 , I. V. Plastinin1 , A. M. Vervald1 , I. I. Vlasov3 , T. A. Dolenko1 2 Moscow ... .phys.msu.ru 1 PACS 61.46.+w, 87.64.-t, 07.05.Kf, 87.85.fk In this study, the results for the solution of the pattern recognition problem are presented -- extraction of ... Use of ANN. ...

Еще в разделе: (Показать все результаты (>24) - rswater.phys.msu.ru/ )

• Laboratory of laser spectroscopy of solutions of supramolecular compounds and
• Ivan Plastinin

... О факультете | ... мисс а.jpg . ... 495) 939-4461 . 495) 939-3749 . ... Виталий Третьяков считает, что телевидение должно иметь 'книжный фундамент', то есть опираться на традиционные культурные ценности человечества.. ... 2009-2014 Высшая школа телевидения МГУ им. М.В.Ломоносова . ...

Еще в разделе: (Показать все результаты (>3) - ftv.msu.ru/ )