... Quick Links ------------------------------- Address Laboratory now Equipment Administration Staff Web-pages Workgroups pages Phone-book, e-mail News Research Grants Publications Education Site Search . The Laboratory of Catalysis and Gas Electrochemistry (CGE) was organized in 1947 on the basis of the Laboratory of Inorganic Catalysis which existed on the Department of Chemistry since 1931. ... Copyright 2001, Laboratory of Catalysis and Gas Electrochemistry, Web-design A.N. Kharlanov. ...

Еще в разделе: (Показать все результаты (>20) - www.kge.msu.ru/ )

This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>93) - neptun.sai.msu.ru/ )

• Apache module mod_vhost_alias
• Apache's Handler Use
• Apache module mod_auth_anon.c

. Pictures from Italy! .

Еще в разделе: (Показать все результаты (>34) - cellmotility.genebee.msu.ru/ )

• publications
• Cell Motility Lab

. Publications . Sorry, this page is under construction. suny-msu . designed by e|g .

Еще в разделе: (Показать все результаты (>13) - suny.msu.ru/ )

• Центр по делам России и США :: Публикации

... Is only visible when cellspacing is larger than 1, or cellborder is 0 , or tablerules is none , otherwise the cell borders overlap the table border. unspecified . ... Table rules, set to "none" (no rules), "groups" (rules will appear between row groups and column groups only), "rows" (rules will appear between rows only), "cols" (rules will appear between columns only), "all" (rules will appear between all rows and columns). ... unspecified . ... This topic: System > Plugins > TablePlugin > VarTABLE...

Еще в разделе: (Показать все результаты (>6641) - wiki.cmc.msu.ru/ )

• PatternSkinCssCookbookEditTableStyle < System < Foswiki
• WikiWord < System < Foswiki

... 2009 .) ... 1 Trade Justice Movement. http://www.tjm.org.uk [on-line] [cited 14 June 2008]; Make Poverty History. http://www.makepovertyhistory.org [on-line] [cited 29 July 2008]; Oxfam. http://www.oxfam.org.uk/ [on-line] [cited 22 June 2008]; World Development Movement. http://www.wdm.org.uk/about/index.htm [on-line] [cited 22 December 2008]; Jubilee Debt Campaign. http://www.jubileedebtcampaign.org.uk/ [on-line] [cited 16 June 2009]. ... http://www.un.org/ru/ [on line] [cited 14 November 2008]. . ...

Еще в разделе: (Показать все результаты (>6384) - hist.msu.ru/ )

• Economic History. Yearbook. 2001
• CEH Publications
• Corporate Social Policy as an Approach to Managing the Workforce: Some Examples

Victor A. Safonov . ... V.A. Safonov. ... Russian Journal of Electrochemistry. ... V.A. Safonov, L.N. Vykhodtseva, A.A. Edigaryan, A.D. Aliev, E.B. Molodkina, A.I. Danilov, E.N. Lubnin, Yu.M. Polukarov. ... L.N. Vykhodtseva, G.E. Chusova, V.A. Safonov, V.N. Korshunov. ... L.N. Vykhodtseva, A.A. Edigaryan, E.N. Lubnin, Yu.M. Polukarov, V.A. Safonov. ... O.V. Safonova, L.N. Vykhodtseva, N.A. Polyakov, J.C. Swarbrick, M. Sikora, P. Glatzel, V.A. Safonov. ... V.A. Safonov, L.N. Vykhodtseva, Yu. ...

Еще в разделе: (Показать все результаты (>85) - electr003.chem.msu.ru/ )

• Boris I. Podlovchenko: Selected Publications
• Jurii M. Maksimov: Selected Publications
• Liana N. Sviridova: Selected Publications

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

Opening ceremony. V. A. Sadovnichij . ... Paul Baum lecture . ... B. Bojarski, A. T. Fomenko, V. A. Sadovnichij . Coffee break team. ... A. T. Fomenko and P. Baum . ... A. Y. Helemsky lecture . ... B. P. Komrakov, A. T. Fomenko, A. Lipkovski . ...

Еще в разделе: (Показать все результаты (>40) - dfgm.math.msu.su/ )

• February 15
• February 16
• February 17

XXIII ICTAM, 19­24 August 2012, Beijing, China CASES OF INTEGRABILITY IN DYNAMICS OF A RIGID BODY INTERACTING WITH A RESISTANT MEDIUM Maxim V. Shamolin Institute of Mechanics, Lomonosov Moscow State University, Moscow, 119899, Russian Federation Summary The author discovers new integrable cases of the rigid body motion in a resisting medium, including those in the classical problem of motion of a spherical pendulum placed in the over-running medium flow. ...

Еще в разделе: (Показать все результаты (>35) - shamolin2.imec.msu.ru/ )

. Sorry, this page under construction. Russian version

Еще в разделе: (Показать все результаты (>67) - www.geol.msu.ru/ )

• Near-surface electrical prospecting laboratory at Moscow University
• Page 3. Publications

... Полная версия этой страницы: Los Alamos Technical Reports and Publications . Студенческий форум Физфака МГУ > Наука физика > Другое . ... 5.1.2009, 1:33 . ... LOS ALAMOS EXPLOSIVES PERFORMANCE DATA . ...

Еще в разделе: (Показать все результаты (>626) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > Каррент мьюзик
• Студенческий форум Физфака МГУ > и еще один новый журнал просит прислать статьи

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>61) - monkey.belozersky.msu.ru/ )

• S publications
• SDPpred
• Example of supporting positions

... Sergey V. Borisov . ... Kaplan A.Ya ., Borisov S.V. , Zheligovsky V.A. Classification of EEG's of adolescents based on spectral and segment parameters for the purposes of schizophrenia diagnostics // Biological Psychiatry, 2005 (ISSN 0006-3223), submitted . Borisov S.V. , Kaplan A.Ya ., Gorbachevskaya N.L., Kozlova I.A. Structural organization of the EEG alpha activity in adolescents with schizophrenic spectrum disorders // Zh . ... Borisov S.V. , Gorbachevskaya N.L., Kaplan A.Ya . ...

Еще в разделе: (Показать все результаты (>52) - brain.bio.msu.ru/ )

• 7th Conference of Biological Psychiatry "Stress and Behavior" -- Moscow, 2003.

... Форумы > Разное > Тема . Автор темы Dr.Neurosurgus . Форумы Список тем Новая тема . ... Publication/Reference Managers . ... чем народ пользуется, чтобы не утонуть в базе ссылок по публикациям по своей теме? . не одними же Reference Manager и ProCite . ... http://forum.khamenya.ru . Ответить Цитировать . ... на сцайнтифике в general форуме . ... Следующая тема Предыдущая тема . ... Сайт работает с 29.08.2000, Copyright 2000 2011 MMOnline.Ru and MMForce.Net, . ...

Еще в разделе: (Показать все результаты (>76) - www.mmonline.ru/ )

• MMOnline | Новости | Международная конференция Combinatorial methods in physics
• Международная конференция Combinatorial methods in physics and knot theory
• MMOnline | Форумы | Разное

University Satellites and . Space Science Education . ... News . ... Internet seminars as the new way of Inter-University Aerospace Centre activity . ... In such a dynamic field as remote sensing, the Internet resources already beat traditional libraries and image depositories. ... In 2000-2005 seven Internet-based seminars were held: "Obtaining satellite images over Internet". ... Images of new types. ... Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>6696) - cosmos.msu.ru/ )

... About CIE MSU . Academic Programmes . Admissions . ... Vestnik CIE (in Russian) . ... Homepage > Admissions > . Study Periods . 2014-2015 academic year . ... One academic year programme: . September 2014 - June 2015 . Arrival Dates . ... August 28 October 31 . June 2015 . One and a half academic year programme: . ... STUDY PROGRAMMES AND COURSE DATES . ... September 20 15 - June 20 16 . ... Study Period . ... Recommended Arrival Dates . ... June 2 6 June 29 . ...

Еще в разделе: (Показать все результаты (>22) - www.cie.ru/ )

• July ? August 2010
• July ? August 2011
• ATTENTION!

Alexander P. Seyranian . Institute of Mechanics , . Moscow State Lomonosov University , . ... Phone: (7495) 939 2039 . Fax: (7495) 939 0165, 939 2065 . ... My field of specialization are Stability Theory, Parametric Resonance, Gyroscopic Stabilization, Mechanics of Solids, Structural Optimization, Singularities and Bifurcations. ... Technical University of Denmark . Aalborg University, Denmark . ... Institute of Engineering Mechanics and Systems, University of Tsukuba, Japan . ...

Еще в разделе: (Показать все результаты (>3) - seyranian.imec.msu.ru/ )

• List of Publications of Prof. Alexander P. Seyranian

General Information . ... The conference is organized by the Sternberg Astronomical Institute (SAI) of Moscow University and the IAU Working group "Site-testing Instruments" . ... Use of site data in telescope operation and adaptive optics. ... Recent conferences on this subject (2007, 2008) demonstrated great interest of the community, hence the need for a new meeting. ... Unlike previous recent conferences, this meeting will cover all aspects of site monitoring for optical/IR astronomy. ...

Еще в разделе: (Показать все результаты (>23) - site2010.sai.msu.ru/ )

• Timetable

ITPM MSU . Quantum Computing Page . ... Quantum Computation/Cryptography at LosAlamos . Quantum Information at Los Alamos National Laboratory . Laboratory for Theoretical and Quantum Computing ( Universite de Montreal ) . Quantum information and quantum computation at IBM . ... Centre for Quantum Computation . Quantum Information Page . Quantum Information and Computation . ... Quantum Information and Quantum Computing (by Reinhard F. Werner) . ... c) ITPM MSU 1998, 1999 ...