I was born on April 12, 1958, in Moscow, USSR, and I have a Russian nationality. I graduated the Lomonosov Moscow State University in 1981, obtained there my Ph.D.degree in 1984 (the topic of the dissertation: "Stellar populations and evolution of galaxies") and a degree of Doctor of Physical-Mathematical Sciences in 1994 (the dissertation "Stellar population of galactic nuclei"). Since 1984 I hold a permanent position at the Sternberg Astronomical Institute (Moscow). ...

Еще в разделе: (Показать все результаты (>48) - sn.sai.msu.ru/ )

• http://sn.sai.msu.ru/~sil/preprints/postbr1.pdf
• http://sn.sai.msu.ru/~sil/preprints/postbr2.pdf

EXAFS Study of the Local Environment of Pb Impurity in CaTiO3, SrTiO3 and BaTiO3 A.A. Veligzhanin2, A.I. Lebedev1, V.V. Mischenko1, I.A. Sluchinskaya1 and A.A. Chernyshov2 1 Moscow State University, Moscow, 119992, Russia 2 RRC Kurchatov Institute, Moscow, 123182, Russia e-mail: swan@scon155.phys.msu.su Ferroelectric properties of perovskite solid solutions are studied extensively for many years. ... The EXAFS spectra were analyzed in the conventional way [3]. ... Ferroelectric crystals. ...

Еще в разделе: (Показать все результаты (>31) - scon155.phys.msu.su/ )

• Irina A. Sluchinskaya
• Ferroelectric - superconductor structures
• Time evolution of an incommensurate structure of Rb2ZnCl4 in uniaxial

Задача получить выравнивание вирусных белков, называемых "малыми дельта-антигенами", посредством программы muscle (читается "массл") и посмотреть на него в GeneDoc. ... Импортируйте файл в GeneDoc. ... Попробуйте разобраться с другими программами выравнивания, установленными на kodomo-count, а именно mafft и/или edialign . ... Посмотреть список программ пакета EMBOSS, имеющих отношения к выравниваниям, можно, выполнив команду wossname alignment Описание конкретной программы выдает программа tfm . ...

Еще в разделе: (Показать все результаты (>27907) - kodomo.fbb.msu.ru/ )

• Help to practice 9 (multiple alignment)
• Task 8 (Multiple alignment)
• Help to practice 11 (Structural alignment)

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>14) - storage.bioinf.fbb.msu.ru/ )

... List of complexes . ... NPIDB, Nucleic acid ? Protein Interaction DataBase provides an access to structured and organized information about all available structures of DNA ? ... Since 2003, the database is available online. ... NPIDB: nucleic acid?protein interaction database . ... An updated version of NPIDB includes new classifications of DNA-protein complexes and their families . ... Sergey Vasilyev (the main developer of the first version of the database) . ... 03-04-48476 (2003 2005) . ...

Еще в разделе: (Показать все результаты (>88) - npidb.belozersky.msu.ru/ )

• NPIDB: Home

... ACAT'2003 : IX INTERNATIONAL WORKSHOP ON ADVANCED COMPUTING AND ANALYSIS TECHNIQUES IN PHYSICS RESEARCH (ACAT03), 1-5 December, 2003, Tsukuba, Japan. ... Advanced Statistical Methods for Data Analysis Traditionally, researchers from high energy and nuclear physics together with experts in computer science take part in the ACAT series of workshops. ... Thus, researchers from these and other fields are welcome to join us in discussions on modern computing techniques and ways for new developments. ...

Еще в разделе: (Показать все результаты (>43) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/hp-grants.html
• http://acat02.sinp.msu.ru/presentations/GGtut/Dev-01-Introduction1.pdf
• http://acat02.sinp.msu.ru/presentations/GGtut/Dev-05-Communication1.pdf

Press release 20 July 2011 New funding for early-career top researchers from anywhere in the world: 730 million for new "ERC Starting Grant" call The European Research Council (ERC) today opens its fifth call for proposals for the "ERC Starting Grants", targeted at early-career top researchers of any nationality, working - or moving to work - in host institutions in Europe. ... Last year, the success rate of Starting Grants proposals was around 15%. ...

Еще в разделе: (Показать все результаты (>34) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/press_release_2011.pdf

... Полная версия этой страницы: Влияние космических лучей на климат . Студенческий форум Физфака МГУ > Наука физика > Конференции, семинары и другие мероприятия . ... The CLOUD Marie Curie Initial Training Network is a multi-site network of 8 Ph.D. students and 2 post-docs at 9 partner institutions across Europe. The network investigates various aspects of the interactions of cosmic rays with aerosols and clouds, which bears on the possibility of a "solar indirect" contribution to climate change. ...

Еще в разделе: (Показать все результаты (>205) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > Магистратура и аспирантура по прикладной теор.
• Студенческий форум Физфака МГУ > PhD positions in Switzerland
• Студенческий форум Физфака МГУ > Доступ к электронным ресурсам

... Further tests of the radiocarbon method of age determination (1 3, 6, 8,1 0) for archaeological and geological samples have been completed. All the samples used were wood dated quite accurately by accepted methods. ... TABLE 1 Age Determinations on Samples of Known Age . ... Specific activities for samples of known age. ... The former sample was cypress wood and the latter acacia. ... This committee advised us what samples of known age to use for testing and greatly assisted us in procuring them. ...

Еще в разделе: (Показать все результаты (>42) - hbar.phys.msu.ru/ )

... Faculty of Basic Medicine, Lomonosov Moscow State University and State Research Center ґ Institute for Biomedical Problems, Russian Academy of Science invite you to take part in "VI Russian National School with International Participation on Muscle and Exercise Physiology "Systemic and cellular mechanisms in physiology of motor system". ... We invite scientists, post-grade students, residents and students to take part in School on systemic and cellular mechanisms in physiology of motor system. ...

Еще в разделе: (Показать все результаты (>10) - fbm.msu.ru/ )

MEMORANDUM OF UNDERSTANDING BETWEEN THE FACULTY of FUNDUMENTAL MEDICINE at the M.V. LOMONOSOV MOSCOW STATE UNIVERSITY ("MSU FFM"), RUSSIAN FEDERATION and the Institute for Cardiovascular Research at the State University of New York, UPSTATE MEDICAL UNIVERSITY, in Syracuse, ny, US ("SUNY ICR") | ... Faculty and researcher exchanges; | ... Clause 1. ... MSU FFM and SUNY ICR have expressed interest in jointly developing a | ... MSU FFM and SUNY ICR express joint interest in exchanging faculty | ...

Еще в разделе: (Показать все результаты (>20) - suny.msu.ru/ )

• Center on Russia and the United States :: Other Russian Programs
• Center on Russia and the United States :: SUNY Russian Programs
• Центр по делам России и США :: Другие проекты в России

... Graduated in 1957 from the Faculty of Mechanics and Mathematics (Moscow State University). Ph.D. in Mathematics and Mechanics (1967). ... Head of the Department of Probability Theory (1996) at the Faculty of Mechanics and Mathematics of Moscow State University. ...

Еще в разделе: (Показать все результаты (>15) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Вестник

Information letter Dear colleagues! Faculty of Basic Medicine, Lomonosov Moscow State University and State Research Center ґ Institute for Biomedical Problems, Russian Academy of Science would like to invite you to participate in the work of the VII Russian National School with International Participation on Muscle and Exercise Physiology ?New approaches to studying of classical problems?. ... Abstracts of reports will be published. ... The receipt of your abstract will be confirmed by e-mail. ...

Еще в разделе: (Показать все результаты (>6) - www.fbm.msu.ru/ )

• http://www.fbm.msu.ru/sci/sno/FLYER%20Summer%20Course%202011.pdf
• http://www.fbm.msu.ru/sci/sno/POST%20CARD%202011.pdf

Technical >> Network (Archive) . ... cepesh : Re: Синхронизация времени [re:september26] 24.04.2003 19:00 | ... fartein.ifi.uio.no=Norway, University of Oslo . ... bitsy.mit.edu=USA, MA, Cambridge, MIT Information Systems . nic.near.net=USA, MA, Cambridge . ... otc1.psu.edu=USA, PA, Penn State University . ... timex.cs.columbia.edu=USA, NY, New York, Columbia University . ... clock-1.cs.cmu.edu=USA, PA, Pittsburgh, Carnegie Mellon University . ... у меня стоят gw.local, ns.msu.ru и ns.msu.net . ...

Еще в разделе: (Показать все результаты (>1908) - www.fds-net.ru/ )

• вопрос про бакалавриат и аспу - Public forum of MSU united student networks
• [вакансия] Специалист по коммуникациям. СколковоТех - Public forum of MSU
• PhD Student Position in Near-field Optics - Public forum of MSU united student

... Osolodkin D.I., Kozlovskaya L.I., Dueva E.V., Dotsenko V.V., Rogova Y.V., Frolov K.A., Krivokolysko S.G., Romanova E.G., Morozov A.S., Karganova G.G., Palyulin V.A., Pentkovski V.M., Zefirov N.S . ... Osolodkin D.I., Palyulin V.A., Zefirov N.S. Glycogen synthase kinase 3 as an anticancer drug target: Novel experimental findings and trends in the design of inhibitors. ... Palyulin V.A., Osolodkin D.I., Zefirov N.S. Virtual Screening Workflow for Glycogen Synthase Kinase 3Ў? Inhibitors. ...

Еще в разделе: (Показать все результаты (>19) - qsar.chem.msu.ru/ )

... Department . ... Department of the Automation for Scientific Research (ASR) was founded in 1988 on the basis of research and teaching group of the Mathematical Physics Department (former Department of Computational Mathematics). ... Under his guidance the department performs wide spectrum of research in the field of computer simulation of complex systems and processes. ... 2008?2016 ASR Department , CMC Faculty , Lomonosov MSU . ...

Еще в разделе: (Показать все результаты (>6) - ani.cmc.msu.ru/ )

• The ASR Department at the CMC Faculty of Lomonosov MSU

... about ANTARES . ... Division of electromagnetic processes and atomic nuclei interactions INP MSU . Division of General Nuclear Physics MSU . Participation of MSU in ANTARES collaboration . Since June, 2009 the group of the Lomonosov Moscow State University takes part in the project. Our group consists of young researchers of MSU Skobeltsyn Nuclear Physics Institute and Faculty of Physics. ... M. Anghinolfi, A. Afanas'ev, V. Kulikovskiy, E. Shirokov . ... MSU, Faculty of Physics, 2009. ...

Еще в разделе: (Показать все результаты (>14) - antares.sinp.msu.ru/ )

• ANTARES in MSU

... Education in the Department starts on the third course. ... The large practical course lasts for 2 years and consists of several parts. ... This project is performed either at the Department of Biochemistry or in the friendly laboratories of the Institute of Physicochemical biology of the Moscow State University, in the Russian Cardiology Centre, in the Institute of Biochemistry or in the Institute of Bioorganic Chemistry of Russian Academy of Sciences and many other scientific institutions of...

Еще в разделе: (Показать все результаты (>11) - biochem.bio.msu.ru/ )

• Biochemistry Department of Moscow State University | History

MGU Botanic Garden . ... The MSU Botanical Garden is not only a valuable scientific institution, but also a place giving joy and a good mood to many people. ... To become a volunteer, please, fill in the application e-form and send it to the following e-mail address: . ... We will contact you on your telephone number within a week of your sending the application. Community work days are also held on the territory of the Garden for different organization and agency workers. ...

Еще в разделе: (Показать все результаты (>8) - botsad.msu.ru/ )

CRIMEAN FIELD GEOLOGICAL CAMP, FIRST YEAR (1st CRIMEAN) . First Crimean Field Camp is organized for the MSU Geological Faculty first year students. ... Professors and researchers from Dynamic Geology Department of Geological Faculty and Russian Academy of Science Institute of Geology are leadind the students. ... SHORT HISTORY OF THE 1st CRIMEAN . ... The main goal of the field camp is to show students how geological processes work now and what we can learn about them in the past. ...

Еще в разделе: (Показать все результаты (>11) - dynamo.geol.msu.ru/ )