обзор! astro-ph/0207223 . ... Author: Sultana N. Nahar . Comments: 15 pgs., 5 color figs., ... Comments: 46 pages including 16 figures, uses eas.cls, to appear in the proceedings of the Aussois 2001 summer school "Stades Ultimes de l'Evolution Stellaire", EAS Pub. ... Comments: 26 pages, 5 figures, submitted to ApJ . ... Commets: 5 pages, 4 figures, to appear in: Pis'ma v Astronomicheskii Zhurnal, 2003, v.29, No.2, p111-115 and will be translated as: Astronomy Letters, v.29, No.2, p.91-95 . ...

Еще в разделе: (Показать все результаты (>354) - astro.uni-altai.ru/ )

• Новости науки

Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...

Еще в разделе: (Показать все результаты (>6957) - mouse.belozersky.msu.ru/ )

• Index of /npidb/pdb
• wLake program homepage

e-mail: eka-dobrenkova@yandex.ru) .., . e-mail: elishev@list.ru) , , , , the youth policy, the public youth policy, models of a public youth policy, "konfessional" the public youth policy . ... Konfessional the public youth policy should be comprehended as the new, fourth model of a public youth policy representing the youth public policy of various types of the religious organisations and associations; as traditional faiths (Orthodoxy, Islam, the Buddhism and a Judaism), and new growths. ...

Еще в разделе: (Показать все результаты (>32) - vestnik.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/archive/2011/3/08.pdf
• http://www.socio.msu.ru/vestnik/archive/2013/3/09.pdf
• http://www.socio.msu.ru/vestnik/archive/2011/4/08.pdf

... 2012. Vaughan, W. Digital Modelling, 2012. ... Heritage, G.L., Large, A.G. Laser scanning for the Environmental Sciences. 2009. ... Ikeuchi, K., Miyakzaki, D. Digitally Archiving Cultural Objects. 2008. ... Digital Human Modelling: Third International Conference, ICDHM 2011, Held at FL, USA, July 9-14 2011.Springer. ... 2010. ...

Еще в разделе: (Показать все результаты (>27) - www.anthropos.msu.ru/ )

... The latter should be taken into account and carefully modeled as a fluid-structure interaction (FSI) problem. A patient- specific FSI analysis is impossible because it predicts only estimated hemodynamic features which are based on assumptions regarding material properties. The objective of this study is to develop a new methodology that assimilates medical imaging data for quantitative hemodynamic data extraction. ...

Еще в разделе: (Показать все результаты (>50) - hit-conf.imec.msu.ru/ )

• http://hit-conf.imec.msu.ru/2012/lectures/index.html
• http://hit-conf.imec.msu.ru/2014/downloads/example.doc

... Master Degree in Geology . Master Degree in Management . Master Degree in Chemistry . ... 29 марта 2016 г. День открытых дверей Высшей школы инновационного бизнеса . ... T he goal of this Master Degree program is to educate specialists with the knowledge of the newest technologies of geological study, modeling and development of deposits, advanced scientific methods of seismic and geophysical exploration, geophysical well-logging, production enhancement, etc. ...

Еще в разделе: (Показать все результаты (>5) - www.hsib.msu.ru/ )

... Publications . ... SPDC Laboratory . Quantum Electronics Chair . ... Mathematical modeling of the accuracy characteristics in problems of precision quantum tomography of biphoton states?, ... A model that approximately takes into account instrumental errors in problems of precision reconstruction of quantum states is considered. ... Various sources of instrumental errors that affect the reconstruction accuracy of quantum states are mathematically modeled. ...

Еще в разделе: (Показать все результаты (>48) - qi.phys.msu.ru/ )

Кафедра биофизики . ... Kovalenko I. B. , Abaturova A. M. , Diakonova A. N. , Ustinin D. M. , Grachev E. A. , Rubin A. B. New direct dynamic models of protein interactions coupled to photosynthetic electron transport reactions // Biophys. ... Коваленко И. Б. , Абатурова А. М. , Громов П. А. , Устинин Д. М. , Грачев Н. Е. , Ризниченко Г. Ю. , Рубин А. Б. Компьютерное моделирование образования комплекса между пластоцианином и цитохромом f в люмене тилакоида Биофизика, 2008, 53 (2) 261-270 . ...

Еще в разделе: (Показать все результаты (>11) - www.biophys.msu.ru/ )

• Сектор информатики и биофизики сложных систем

... It also makes sense to assume in most instances, those who purchases a fake designer item doesn?t know it?s fake until well after the purchase is made, if previously. ... It was Christian dior who invented the Fresh look that revolutionised the way women wearing the 40s. The style was the essence of femininity and glamour over time of austerity. I have designed flower women, . ... Dior said of his new voluptuous model, . ... That is the feel that discovers in might be dior perfumes, . ...

Еще в разделе: (Показать все результаты (>37) - elana.sinp.msu.ru/ )

• ralph lauren outlet uk 6 million cars worldwide | С Днем Победы!
• longchamp outlet Bikeshed | С Днем Победы!
• cheap michael kors uk Daily Record | С Днем Победы!

... Oxidative stress induced in rat brain by a combination of 3-nitropropionic acid and global ischemia. ... Combination of global ischemia induced by 3-vessel occlusion of major arteries supplys rat brain and subsequent 5-day reperfusion with intraperitoneal injection of 3-nitropropionic acid induces vigorous oxidative stress in brain tissues accompanied by evident neurological symptoms in Wistar rats. ...

Еще в разделе: (Показать все результаты (>35) - biochem.bio.msu.ru/ )

• [Search for chaperon-like anticataract drugs, the antiaggregants of lens
• Expression of NMDA receptors in multipotent stromal cells of human adipose
• Human pro-B-type natriuretic peptide is processed in the circulation in a rat

... Квантовая теория . ... Непертурбативная низкоэнергетическая физика адронов и лептонов (руководители - проф. К.А.Свешников, проф. А.Е.Дорохов). ... Методы квантовой теории поля в физике конденсированного состояния (руководители - с.н.с. О.В.Павловский, с.н.с. М.В.Улыбышев). Кафедра активно участвует в организации и проведении ежегодных международных семинаров по проблемам квантовой теории поля и теории гравитации в ИФВЭ - Протвино. ... Phys. Rev. D 85 (2012) 094022, arXiv: 1110.6059. ...

Еще в разделе: (Показать все результаты (>42) - hep.phys.msu.ru/ )

... One of the project objectives was to investigate practical efficiency of some modern iterative methods, including multigrid techniques and domain decomposition methods as well as methods for small compressible materials. ... Hence, the project research initiated because of INTAS financial support contributes in setting up modern computational techniques in tire design. ... Research on efficiency of iterative methods was conducted at the department of Mechanics of Composites about ten years ago. ...

Еще в разделе: (Показать все результаты (>16) - composite.msu.ru/ )

Межфакультетский курс ?Математическое моделирование и численное исследование актуальных проблем физики плазмы? (Mathematical modeling and numerical research of the actual problems in the plasma physics) (весенний семестр 2015-2016 уч. г., 24 часа, зачет) Лектор: Козлов Андрей Николаевич, (м.т. 8-915-401-63-92, andrey-n-kozlov@mail.ru ) д.ф.-м.н., профессор кафедры вычислительной механики мех.-мат. факультета, зав. кафедры академик В.А.Левин Программа курса лекций проф. А.Н.Козлова 1. ...

Еще в разделе: (Показать все результаты (>4) - new.mfk.msu.ru/ )

• http://new.mfk.msu.ru/uploads/attachments/attachment_188_1454312716.doc

MSU . Science Park . ... Prototyping center . Engineering formula . ... Center for Youth Innovation Creativity and Prototyping at Moscow State University Science Park is focused on work with pupils and students to familiarize them with the capabilities of modern equipment and engaging in scientific and technical activities. ... The main goal of the Center - provide opportunities for children and young people to fulfill themselves in scientific and technical work. ... JSC "MSU Science Park" . ...

Еще в разделе: (Показать все результаты (>3) - www.sciencepark.ru/ )

... The Department of Operations Research . ... Coordinators Contacts . ... on Operations Research, . ... Moscow, April 10-14, 2007 Coordinators . ... 1) New models and methods . Prof. V.V. Morozov . ... 3) Multiple objective decision making . ... Prof. I.G. Pospelov, Prof. A.A. Shananin . ... Prof. A.A. Belolipetckiy . ... 9) Game-theoretic models . ... Symposium A: Analysis of the markets and decision making in electric power industry . ... Symposium B: Models of political decision making. ...

Еще в разделе: (Показать все результаты (>4) - io.cs.msu.ru/ )

• Traditional topics of the conference - ORM 2007

... J.Vladimirova, B.Grishanin, V.Zadkov, V.Biancalana, G.Bevilacqua, Y.Dancheva, L.Moi, "Computer modeling of frequency-modulation spectra of coherent dark resonances", Laser Physics Lett., ... Yu.V.Vladimirova, B.A.Grishanin, D.V.Zhdanov, V.N.Zadkov, and H.Takahashi, "Laser asymmetric synthesis of enantiomers of hydrogen peroxide molecules from a racemic mixture without preliminary molecular orientation", Bulletin of Moscow State Univ, Ser. ... Physics. ... 2016 Quantum Information Laboratory. ...

Еще в разделе: (Показать все результаты (>75) - qilab.phys.msu.ru/ )

... Single station indices on the level of cosmic ray activity . Real time cosmic ray variation on Moscow Neutron Monitor . Apatity and Barentsburg cosmic ray stations . Arctic Center Cosmophysical Prognosis (Russian version) . Arctic Center Cosmophysical Prognosis (English version) . Data Base of Yakutsk, Tixie Bay and others neutron monitors (since Jan 1, 1980 ) . Aragats Neutron Monitor . ... Model of Galactic Cosmic Rays (SINP MSU GCR model) . ...

Еще в разделе: (Показать все результаты (>6) - dbserv.sinp.msu.ru/ )

• Links

... if (B1) { S1; } if (B1) { S1; } if (B2) { S2; } - - ...exp... int x = 1; if (x == 1) { std::cout << "Okay" << std::endl; } else { std::cout << "Error" << std::endl; } -- ґ int strlen(const char* p) { int len = 0; do { ++len; } while (*p++); return len; } ??, ?bbb? -- , : Ї ґ , , Ї ґ , , Ї ґ , Ї ґ . ... 1977 ґ LTL, Ї , 1981 ґ (CTL), Ї , , 1981 , , 1982 ґ model checking ( ), Ї , 1986 ґ model checking ( ), Ї , 1989 ґ SPIN. ... The Spin Model Checker: Primer and Reference Manual, Addison Wesley, 2003. ...

Еще в разделе: (Показать все результаты (>2) - savenkov.lvk.cs.msu.su/ )

Another mechanical model of parametrically excited pendulum and stabilization of its inverted equilibrium position Anton O. Belyakov 1 Lomonosov Moscow State University 2 Vienna University of Technology 8th European Nonlinear Dynamics Conference (ENOC 2014) Vienna, July 7, 2014 Scheme of a parametric pendulum y O l (t ) - g m 2 r1 + m 2 Equations of motion mr 2 1 d d2 + c1 + m g l (t ) sin () = 0 dt 2 dt (1) Dimensionless equation Three dimensionless parameters and ...

Еще в разделе: (Показать все результаты (>10) - belyakov.imec.msu.ru/ )

• Anton O. Belyakov

... Bohm limit DB=vrg/3: Emax Emax ush 0.3 Ze B Rsh c 1014(B/Bism) Z eV B Hillas criterion ! ... Voelk 2000; Kang Jones 2006) - Bohm diffusion in amplified magnetic field B2/8 = 0.035 u2/2 ( Voelk et al. 2005 empirical; Bell 2004 , Zirakashvili VP 2008 theoretical) - account for Alfvenic drift w = u + Va upstream and downstream - relative SNR rates: SN Ia : IIP : Ib/c : IIb = 0.32 : 0.44 : 0.22 : 0.02 Chevalier 2004 , Leaman 2008, Smart et al 2004, Berezinsky et al 2006 Das et al. ...

Еще в разделе: (Показать все результаты (>7) - tunka.sinp.msu.ru/ )

• http://tunka.sinp.msu.ru/en/presentation/Zirakashvili.pdf