Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...

Еще в разделе: (Показать все результаты (>3689) - mouse.belozersky.msu.ru/ )

• Index of /npidb/pdb
• wLake program homepage

... 2012. Vaughan, W. Digital Modelling, 2012. ... Heritage, G.L., Large, A.G. Laser scanning for the Environmental Sciences. 2009. ... Ikeuchi, K., Miyakzaki, D. Digitally Archiving Cultural Objects. 2008. ... Digital Human Modelling: Third International Conference, ICDHM 2011, Held at FL, USA, July 9-14 2011.Springer. ... 2010. ...

Еще в разделе: (Показать все результаты (>30) - www.anthropos.msu.ru/ )

... В работе рассматривается двухмерная математическая модель лесных пожаров, приводится алгоритм численного решения и результаты тестовых расчетов. ... В работе [1] была предложена двухмерная модель лесных пожаров, построенная методом осреднения исходных трехмерных уравнений газовой динамики по высоте слоя лесных горючих материалов, который рассматривается как одноярусная двухфазная (газовая и твердая фазы) двухтемпературная реакционноспособная среда. ... Газовая фаза: . ... коэффициент диффузии, . ...

Еще в разделе: (Показать все результаты (>56) - www.library.biophys.msu.ru/ )

• МОДЕЛЬ ДИНАМИКИ БИОМАССЫ ЖИВОГО НАПОЧВЕННОГО ПОКРОВА В ЛЕСУ
• ЖИЗНЕСПОСОБНОСТЬ ПОПУЛЯЦИЙ ПРИ ИМПУЛЬСНОМ ВОЗДЕЙСТВИИ ТОКСИКАНТОВ
• МОДЕЛИРОВАНИЕ ВЗАИМОДЕЙСТВИЯ МАГНИТНОГО ПОЛЯ С ОБЪЕМНЫМИ ВЯЗАНЫМИ СТРУКТУРАМИ

... Medium (solvent) coordinates 3. Quantum effect of solvent on activation barrier 4. ... sucrose solutions: C D ( w) = + + 1 + (iw C ) 1 + iw water-EG mixtures: D 3 1 2 ( ) = + + + 1 + i 2 1 1 + i 2 2 1 + i 2 3 series N solvent modes Solvent reorganization energy (exact expansion ) correlation times K ( ) = 2k BT Solvent correlation function i =1 N i exp (- / ) * i i =1 N i = 1 i is the contribution of i-th mode to the solvent reorganization energy The solvent reorganization ...

Еще в разделе: (Показать все результаты (>14) - www.elch.chem.msu.ru/ )

• Molecular aspects of solid state and interfacial electrochemistry
• Galina A. Tsirlina

... Publications . ... SPDC Laboratory . Quantum Electronics Chair . ... Mathematical modeling of the accuracy characteristics in problems of precision quantum tomography of biphoton states?, ... A model that approximately takes into account instrumental errors in problems of precision reconstruction of quantum states is considered. ... Various sources of instrumental errors that affect the reconstruction accuracy of quantum states are mathematically modeled. ...

Еще в разделе: (Показать все результаты (>70) - qi.phys.msu.ru/ )

... Master Degree in Geology . Master Degree in Management . Master Degree in Chemistry . ... 29 марта 2016 г. День открытых дверей Высшей школы инновационного бизнеса . ... T he goal of this Master Degree program is to educate specialists with the knowledge of the newest technologies of geological study, modeling and development of deposits, advanced scientific methods of seismic and geophysical exploration, geophysical well-logging, production enhancement, etc. ...

Еще в разделе: (Показать все результаты (>5) - www.hsib.msu.ru/ )

... Геология >> Геотектоника | ... Добавить новое сообщение . ... Учебное пособие "Введение в тектонофизику". Гончаров М. А., Талицкий В. Г., Фролова Н. С. Ответ. ... Тезисы научной конференции ЛОМОНОСОВСКИЕ ЧТЕНИЯ, ноябрь 2011 года СЕКЦИЯ ГЕОЛОГИЯ: . ...

Еще в разделе: (Показать все результаты (>73) - phys.web.ru/ )

... Oxidative stress induced in rat brain by a combination of 3-nitropropionic acid and global ischemia. ... Combination of global ischemia induced by 3-vessel occlusion of major arteries supplys rat brain and subsequent 5-day reperfusion with intraperitoneal injection of 3-nitropropionic acid induces vigorous oxidative stress in brain tissues accompanied by evident neurological symptoms in Wistar rats. ...

Еще в разделе: (Показать все результаты (>67) - biochem.bio.msu.ru/ )

• Human pro-B-type natriuretic peptide is processed in the circulation in a rat
• [Search for chaperon-like anticataract drugs, the antiaggregants of lens
• Expression of NMDA receptors in multipotent stromal cells of human adipose

Retention of Plutonium on Model Kaolin-Humic Complexes Vladimir Kholodov1, Alexander Novikov2, Tatiana Goriachenkova2, Irina Kozinskaja2, Irina Perminova 1 2 3 Dokuchaev Soil Institute, Pyzhevskiy per. ... 19, 119991, Chair of Organic Chemistry, Department of Chemistry, Moscow State University, Leninskie gory, Moscow, Russia, 3 119992, Moscow, Russia Keywords: kaolin-humic complexes, plutonium, adsorption, desorption 1. ... Kaolinite is the most abundant clay mineral. ...

Еще в разделе: (Показать все результаты (>127) - mgumus.chem.msu.ru/ )

• MGUMUS -- Current projects
• MGUMUS -- First International Conference on Humics-based Innovative
• MGUMUS -- Первая международная конференция по гуминовым инновационным

... The influence of impurities on the ferroelectric phase transitions was the subject of intensive studies in recent years. ... The purpose of this work was to study the environment of different impurities and the Ge atoms in GeTe in order to elucidate the mechanisms of the interaction between off-center Ge atoms and impurities. ... EXAFS experiments were done at Daresbury Laboratory on GeTe 1-x Se x (x=0.1-0.3), Ge 0.9 Pb 0.1 Te and Ge 1-x Mn x Te (x=0.1, 0.2) samples at 77 K in transmission mode. ...

Еще в разделе: (Показать все результаты (>82) - scon155.phys.msu.su/ )

• Non-monotone kinetics of persistent photoconductivity in compensated a-Si:H
• EXAFS studies of the local structure of In in PbTe, SnTe and GeTe

Gamma-quanta from SNRs V.N.Zirakashvili Pushkov Institute of Terrestrial Magnetism, Ionosphere and Radiowave Propagation, Russian Academy of Sciences (IZMIRAN), 142190 Troitsk, Moscow Region, Russia Outline · Acceleration of particles at forward and reverse shocks in SNRs · Amplification of magnetic fields · Modeling of broad-band emission · Radioactivity and electron acceleration Diffusive Shock ... 2010) . ... Cosmic ray positrons can be accelerated at reverse shocks of SNRs. ...

Еще в разделе: (Показать все результаты (>7) - tunka.sinp.msu.ru/ )

• http://tunka.sinp.msu.ru/en/presentation/Ptuskin.pdf

... О кафедре . ... КРИВОНОЖКО Владимир Егорович (11.06.1948, г. Москва) д.физ.-мат.н., профессор МФТИ, зав. кафедры АСУ МИСИС. ... Krivonozhko V. E., F rsund F. R. Lychev A. V. Terminal units in DEA: Definition and Determination // University of Oslo. ... F rsund F. R., Krivonozhko V. E., Lychev A. V. Hidden Effects in DEA Models //Differential Equations. ... Krivonozhko V. E., F rsund F. R., Lychev A. V. Some Ulterior Effects in the DEA models // Abstracts of the INFORMS Annual Meeting. ...

Еще в разделе: (Показать все результаты (>4) - ndsipu.cmc.msu.ru/ )

... One of the project objectives was to investigate practical efficiency of some modern iterative methods, including multigrid techniques and domain decomposition methods as well as methods for small compressible materials. ... Hence, the project research initiated because of INTAS financial support contributes in setting up modern computational techniques in tire design. ... Research on efficiency of iterative methods was conducted at the department of Mechanics of Composites about ten years ago. ...

Еще в разделе: (Показать все результаты (>4) - composite.msu.ru/ )

... Single station indices on the level of cosmic ray activity . Real time cosmic ray variation on Moscow Neutron Monitor . Apatity and Barentsburg cosmic ray stations . Arctic Center Cosmophysical Prognosis (Russian version) . Arctic Center Cosmophysical Prognosis (English version) . Data Base of Yakutsk, Tixie Bay and others neutron monitors (since Jan 1, 1980 ) . Aragats Neutron Monitor . ... Model of Galactic Cosmic Rays (SINP MSU GCR model) . ...

Еще в разделе: (Показать все результаты (>8) - dbserv.sinp.msu.ru/ )

• Links

Information Security Meeting Schedule Thursday, March 30 12:00 noon Opening and Catered Lunch 1:00 R. Sekar, Stony Brook University - Ongoing Research at Secure Systems Laboratory at Stony Brook University 1:30 Scott Craver, Binghamton University - Information Hiding and Counterdeception 2:00 Sanjay Goel, University at ...

Еще в разделе: (Показать все результаты (>6) - suny.msu.ru/ )

Theory as a Lighthouse in the Electrochemical Ocean . In memory of Alexander M. Kuznetsov . ... Until his last days he continued to work on various aspects of charge transfer phenomena. ... In electrochemical kinetics the theory always outruns the experiment, and the quantum mechanical theory of charge transfer created in the famous Theoretical Department of the Frumkin Institute in Moscow (R.R. Dogonadze, A.M. Kuznetsov and co-authors) is a good example for that. ...

Еще в разделе: (Показать все результаты (>116) - electr003.chem.msu.ru/ )

• Laboratory of Electrochemical energetics
• Liana N. Sviridova: Selected Publications
• Elena V. Stenina: Selected Publications

... FPGA design, architecture, means and methods of work. ... FPGA stands for Field-Programmable Gate Array, which is a semi-conductive crystal, the connections between gates of which and the logic of work can be modeled and changed repeatedly during its work. ... Each semester has 12 obligatory classes of four (4) academic hours each once a week, which totals in 48 hours per semester. ... In spring semester students have 44 hours to work on their term papers on design and then 4 hours for defending...

Еще в разделе: (Показать все результаты (>12) - engineering.phys.msu.ru/ )

• Introduction to Linux

... CUDA Center of Excellence | MSU . ... Lomonosov Moscow State University (MSU) was awarded an NVIDIA CUDA Center of Excellence (CCOE) in 2011 for being one of the first Russian universities to recognize the importance of emerging GPU technologies and first to embrace CUDA. ... Lomonosov Moscow State University (MSU) is renowned as one of the leading computer science centers excelling in application of computational resources to address most vital scientific problems. ...

Еще в разделе: (Показать все результаты (>4) - ccoe.msu.ru/ )

... В.И.Дмитриев Электромагнитные поля в неоднородных средах Изд-во Моск. ун-та, Москва 1969, с.131 . ... Изд-во 'Диалог-МГУ', 1997,с.168. ... Прикладная математика и информатика', Изд-во 'Диалог-МГУ', 1999,с. 68-77. ... Прикладная математика и информатика', изд-во 'МАКС Пресс', Москва, 2001г.,?7, с.5-18. ... В трудах 'Прикладная математика и информатика', ?2, Изд-во 'Диалог-МГУ', 1999,с. 5-17 . ... Сборник работ 'Прикладная математика и информатика', изд-во 'МАКС Пресс', Москва, 2001г., ?9, с. 46. ...

Еще в разделе: (Показать все результаты (>4) - lmph.cmc.msu.ru/ )

• Лаборатория Математической Физики.

... info@ecfs.msu.ru . All contacts . ... for Food Security . Home About Economic Department . ... Contacts . ... Ph.D.: Agricultural Economics 2011 (Economical Description and Development Scenarios of Russian Potato and Vegetable Sectors)€а . WORK: March 2007 тАУ June 2014 Senior researcher in Russian Institute of Agricultural Problems and Informatics, n.a. A.A. Nikonov (VIAPI); From July 2014 тАУ the head of Economic Department in Eurasian Center for Food Security in MSU (ECFS)€а . ...

Еще в разделе: (Показать все результаты (>16) - ecfs.msu.ru/ )