. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>253) - monkey.belozersky.msu.ru/ )

• SDPpred
• About authors ot this complex
• Example of supporting positions

... After defining such concepts as the adaptive system, reflection, the sign, meaning, sense, identification and recognition, it is easy to develop our ideas on the nature of modelling , whose role is in general becoming constantly more important in scientific work, and this is especially true in cybernetics. ... Language to describe senses. ... Shall we obtain a correct reflection of a text's sense structure if we transfer all the linguistic units of a natural text into "senses language". ...

Еще в разделе: (Показать все результаты (>56) - old.philol.msu.ru/ )

• Using Markov Chains for Identification of Writers
• MSU-LGCLL:: Krylov J.K. - On the Nature of Koehler's Effect
• Basic Assumptions about a Sign's Life Cycle for Mathematical Modelling of

... id #527 . Journal of Biological Standardization [not defined] . Common information . ... no information] . ... since 1900-01-01 till today . ... http://www.sciencedirect.com/science/.. ... 1973-01-01 . 1989-12-31 . ...

Еще в разделе: (Показать все результаты (>45) - journals.genebee.msu.ru/ )

... 2000 September 10 . White Dwarf Stars Cool . ... WFPC2 , HST , NASA . Explanation: Diminutive by stellar standards , white dwarf stars are also intensely hot ... but they are cooling. ... Here, researchers have discovered a large concentration of white dwarf stars (circled above). ... Studying how these stars cool could lead to a better understanding of their ages, of the age of their parent globular cluster , and even the age of our universe . ... About APOD | ... NASA Technical Rep.: ...

Еще в разделе: (Показать все результаты (>20) - www.arcetri.astro.it/ )

... Second-year students classes . ... The course offers profound description of popular techniques of parallel programming such as OpenMP and MPI. ... Rapid growth of productivity of the modern computing systems is achieved by using parallel processors and multicore systems. ... As a result, by the and this course, students acquire knowledge about the popular parallel programming techniques, knowledge of modern high-performance computing systems and practical skills to work with them. ... Moscow: Binom...

Еще в разделе: (Показать все результаты (>15) - engineering.phys.msu.ru/ )

• Microcontroller Programming
• Introduction to Linux

COVER STORY CHA HEALTH SYSTEMS: C LEAding THE HEALTHCArE induSTrY THrougH TrAnSLATionAL rESEArCH HA Health Systems (CHA) has been at the forefront of many innovations in the healthcare industry, and with a comprehensive network that includes hospitals, clinics, research institutions, university and a biotech corporation ­ is poised to set the standard in healthcare for future generations. ... Develop ­ this is where CHA develops new technologies into real solutions for the healthcare industry. ...

Еще в разделе: (Показать все результаты (>368) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Обсуждение материала "Каждый рабочий день в Канаде
• Клуб выпускников МГУ: "Скромные банки"
• Клуб выпускников МГУ: Каждый рабочий день в Канаде погибает пять человек

... However, our studies show that Prosilica EC650 has very good p erformance to use as DIMM image detector. ... The sub-directories /opt/dimm/data/out for the output data file, /opt/dimm/data/log for the output log file yymmdd-dimm.log and /opt/dimm/etc for the configuration file must b e created. ... Pictures mode The Pictures mode provides grabbing of the star b ox images and storing their sequence as one output file "b oxrecord.fits" in /opt/dimm/data/images/ sub directory. ...

Еще в разделе: (Показать все результаты (>23) - curl.sai.msu.ru/ )

• http://curl.sai.msu.ru/mass/download/doc/infrasoft_eng.pdf
• atmos 3.0 page

... - behave-, believe-, blurred-, body- border- both-; ... , ... bottom-, bursary- but-, , ; ; , calculate-, capable-, , carry-, ~ away - ~out- Cartesian- case-, cause-; cathode- centre- 4 certainly-, champion- (- ), , , change-, , characterise-() characteristic-, ... weight- whereas- while-, whole-, wide-, , width- witness-, wonder- no ~ - worth- to be ~ doing smth- - Y yield- Z zinc- 35 ...

Еще в разделе: (Показать все результаты (>25) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/Sample_theses.pdf
• http://www.eng.math.msu.su/download/theses3.pdf
• http://www.eng.math.msu.su/download/Model_rendering.pdf

Psychology in Russia: State of the Art · 2012 Subjec tive PreferenceS of criterion-oriented SuPPort of ProfeSSional ac tivitieS of ManagerS Fairuza S. Ismagilova, Galina S. Mirolyubova First Russian President B.N. Yeltsyn Ural Federal University, Yekaterinburg, Russia This article deals with the results of a pilot research of a subjective system of activity criteria represented in professional experience of business managers from the Ural region. ...

Еще в разделе: (Показать все результаты (>158) - www.psy.msu.ru/ )

• http://www.psy.msu.ru/science/psyrussia/2013/asmolov.pdf
• http://www.psy.msu.ru/science/psyrussia/2012/astaeva.pdf
• http://www.psy.msu.ru/science/psyrussia/2013-2/zinchenko_pr_2013_2.pdf

. This is the first one I have actually out and out missed. I had even checked it against a second generation DSS scan and just decided it was a non-symetrical nucleus. The estimated magnitude is about 15.7. Mike Schwartz , Director . Tenagra Observatories, Ltd. Cottage Grove, OR 97424 . Back to Bright Supernovae . Back to Supernova 1999an . David Bishop Last modified: Fri Mar 12 12:20:43 EST 1999

Еще в разделе: (Показать все результаты (>273) - www.rochesterastronomy.org/ )

• Supernova 2007uy and 2008D in NGC 2770
• Supernova 2002fk in NGC 1309
• Supernova 2009js in NGC 918

Letter pubs.acs.org/NanoLett Enhanced Third-Harmonic Generation in Silicon Nanoparticles Driven by Magnetic Response Maxim R. Shcherbakov,*, Dragomir N. Neshev, Ben Hopkins, Alexander S. Shorokhov, Isabelle Staude, Elizaveta V. Melik-Gaykazyan ... In our experiment, we address silicon nanodisks placed on silica as shown in Figure 1. ... The THG resonance is seen to be split into two. ... We extract the electric and magnetic dipole 6490 Letter Figure 3. (a) THG spectroscopy of Si nanodisk arrays. ...

Еще в разделе: (Показать все результаты (>76) - nanolab.phys.msu.ru/ )

• http://nanolab.phys.msu.ru/sites/default/files/paper_nonlinear.pdf
• http://nanolab.phys.msu.ru/sites/default/files/thg_in_fishnet.pdf
• http://nanolab.phys.msu.ru/sites/default/files/acsphotonics.pdf

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>22) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

Image inpainting Outline · Why inpaint? Image filtering ( convolution ), simplest inpainting · Heat flow, diffusion process, diffusion equation · Anisotropic diffusion · Further development Partly taken from Restoring profanity by Carola SchЖnlieb Inpainting applications · · · · Image restoration Object removal Text removal Special effects Image courtesy Andrea Baczynski Simplest inpainting · ... Apply Matlab's median filter function medfilt2 on the Mandrill and Lena images. ...

Еще в разделе: (Показать все результаты (>12) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2013.PRIA.Mamaev_Lukin_Yurin.HermiteNLM.en.pdf
• http://imaging.cs.msu.su/~yurin/Doxyfile
• http://imaging.cs.msu.ru/pub/2013.PRIA.Levashov_Yurin.RidgeAndTree.en.pdf

... Science . ... 15:00 S.A. Akhmanov Hall, Nonlinear Optics Bld. ... Home Science and education Scientific Laboratories Laboratory of nonlinear polarization optics . ... The mechanisms of evolution of polarization during radiation propagation in nonlinear media with nonlocality of optical response. ... As a result, a new field of science has originated, the nonlinear polarization optics, providing new insights into the interplay of polarization effects in classic nonlinear optical processes. ...

Еще в разделе: (Показать все результаты (>107) - ilc.phys.msu.ru/ )

• Publication
• Публикация
• "Computers and measurements" practical course laboratory

ВМиК-Online! ... Студенты . ... Выпускники . Работа . ... Компания HP создает новые возможности для того, чтобы технологии приносили максимальную пользу людям, компаниям, государственным структурам и обществу в целом. ... Бизнес HP в России уже 6 лет подряд показывает результаты лучше рынка ИТ в целом. ... Вакансии компании Hewlett-Packard: . ... Телефон компании HP: +7 (495) 797-35-00. ... МГУ . ... Рейтинг компаний составляется на основе данных Клуба выпускников МГУ . ... 2001 2012 ВМиК Online! ...

Еще в разделе: (Показать все результаты (>6) - www.cmc-online.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

Aleksanteri Institute Visiting Scholars Programme Aleksanteri Visiting Fellowships 2013 ­2014 THE FELLOWSHIP Is intended for scholars who hold a PhD degree in a field relevant to the Aleksanteri Institute 's research agenda and whose place of residence i s outside of Finland Is for a period of two to three months between August 2013 and June 2014 Involves a research stay at the Aleksanteri ... An electronic application form 2. ... The applications are evaluated by three experts. ...

Еще в разделе: (Показать все результаты (>125) - www.mgubs.ru/ )

• http://www.mgubs.ru/images/Image/IFP%202011%20brochure.pdf
• http://www.mgubs.ru/images/Image/Aleksanteri_Visiting_Fellowships_2011-2012.pdf
• Прием заявок на конференцию "Managing by Values - beyond Cultures and

... CpAppro . ... TernAPI program . ... Home Our Developments CpAppro . ... The above equation is a linear combination of thermodynamic functions of the harmonic oscillator (Planck-Einstein functions). This approach is developed as a part of a universal method of approximating temperature dependences of standard thermodynamic properties for crystalline substances. ... Colloquium on 24.12.12 20 Dec 2012 . ... Laboratory of Chemical Thermodynamics . ... 2000-2016 Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>7) - td.chem.msu.ru/ )

Journal of Biotechnology 58 (1997) 187 ­ 195 Rapid SDS -GEL capillary electrophoresis for the analysis of recombinant NADP + -dependent formate dehydrogenase during expression in Escherichia coli cells and its purification V. Klyushnichenko *, V. Tishkov, M.-R. Kula Institute of Enzyme Technology, Heinrich -Heine Uni6ersity Dusseldorf, D -52426 Julich ... Purification of FDH 2. ... Klyushnichenko, V., Kula, M.-R., 1997a. Rapid SDS Gel Capillary Electrophoretic analysis of proteins. ...

Еще в разделе: (Показать все результаты (>121) - www.enzyme.chem.msu.ru/ )

• http://www.enzyme.chem.msu.ru/bc2007/Hotel_accommodation_in_Moscow.pdf
• Tetrahedron Letters : A Novel, Efficient Regenerating Method of NADPH Using a
• PubMed medline query

LOCAL TSUNAMI WARNING AND MITIGATION ________________________________________________________________________________________________________________________________________ HYDROACOUSTIC ANTENNA : A POWERFUL TOOL TO FORECAST TSUNAMIGENIC EARTHQUAKES Yakov S. Karlik Central Research Institute MORPHYSPRIBOR , 46 Chkalovsky proezd, Sankt-Petersburg, 197378 Russia E-mail: karlik@mail.cl.spb.ru ABSTRACT Hydroacoustic antenna ... 2001). ... Eiby, J.A., 1982: Earthquakes. ...

Еще в разделе: (Показать все результаты (>25) - seac47-2.phys.msu.ru/ )

• LOCAL TSUNAMI WARNING AND MITIGATION -- Proceedings Download Page