1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

Lomonosov Moscow State University was established in 1755 . ... MSU Web Sites . ... Faculties . ... Study and Research . ... COME TO MOSCOW, RUSSIA AND BRING ALL ORIGINAL DOCUMENTS WITH YOU . ... Document of the previous degree (MA or Specialist degree) with a notarized translation into Russian ; . ... To get a letter of invitation, necessary for receiving a student visa, please send (via mail, fax or e-mail) the following documents to the Department of international studies of the chosen faculty: . ...

Еще в разделе: (Показать все результаты (>67) - www.msu.ru/ )

• Bachelor studies
• Master studies
• Specialist studies

Еще в разделе: (Показать все результаты (>2) - www.womenmsu.msu.ru/ )

... K. Krylov . There was undertaken a research of lengthes of marinon - some integral units obtained by segmenting of comleted (whole) fiction prosaic texts (stories, small novels, novels). ... Overall corpus of considereded texts (Russian fiction prosaic) contain more than two million of graphic running words. Undertaken research has lead us to revealing of three main regularities. 1) to formulation of the law of optimum relation between number of elements within each submicroscopic level; . ...

Еще в разделе: (Показать все результаты (>56) - old.philol.msu.ru/ )

• MSU-LGCLL:: O.V. Kukushkina, A.A. Polikarpov, D.V. Khmelev - Authorship
• Using Literal and Grammatical Statistics\\ for Authorship Attribution
• TRUE WRITER RECOGNITION

Официальный сайт кафедры Математической теории интеллектуальных систем и . ... Announcement of the Availability of the LSI Logic International Services Scholarship to Post-Graduate Students of Moscow State University and Moscow Institute of Physics and Technology . ... Interested applicants should submit the following documents not later than September 26, 2003 : . ... 2001-2015 г. Кафедра Математической теории интеллектуальных систем, лаборатория Проблем теоретической кибернетики . ...

Еще в разделе: (Показать все результаты (>102) - www.intsys.msu.ru/ )

• Intelligent Systems :: Science :: Conference
• Intelligent Systems :: Staff :: Zhuk Dmitriy
• Intelligent Systems :: Research :: :: Articles

BUSINESS ENGLISH LESSON PLAN FOR THE 2nd YEAR STUDENTS: II SEMESTER OF 2012-2013 ACADEMIC YEAR Compiled by: A.S. Matveeva Edited by: L.N. Vygonskaya This business English lesson plan has been designed for students of the Faculty of Mechanics and Mathematics who need to improve their business and social English skills rapidly, effectively and efficiently. ... The subject can be presented orally and students can be asked to contribute any relevant vocabulary they may already have. ... Home Task. ...

Еще в разделе: (Показать все результаты (>20) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/section_1.pdf
• http://www.eng.math.msu.su/download/Model_rendering.pdf

... Meeting at the Russian Union of Rectors International Conference on the Arctic WWF calls to protect the Arctic The President signs law on radioactive waste The problems of Lake Baikal Cleaning of Russia 's Arctic zone Moscow is expanding Moscow goes for selective waste collection Protected areas on land being connected to Moscow Discussion of Moscow 's program for Environmental Protection New protected ... Source: Russian Prime Minister V. Putin's site. ...

Еще в разделе: (Показать все результаты (>274) - www.geogr.msu.ru/ )

• http://www.geogr.msu.ru/science/projects/our/ross_swed/NewsLETTER/1_11.pdf
• wnsvnttw iybtwjfpGS (все сообщения)
• Instructions for Authors, contributing to “GEOGRAPHY, ENVIRONMENT,

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

... Siberian Lang . Minority languages of Siberia as our cultural heritage . ... The project ?Development of the web-site ?Minority languages of Siberia as our cultural heritage? (on the material of the languages of the basin Middle Yenisei and the Middle and the Upper Taz)? was realized at the Laboratory for Computational Lexicography, Research Computing Centre, Lomonosov Moscow State University, with financial support from Russian Foundation for the Humanities, grant 12-04-12049.љ ...

Еще в разделе: (Показать все результаты (>3) - siberian-lang.srcc.msu.ru/ )

Diploma thesis abstract model describing the recently observed femtosecond oscillations in bacterial photoreaction centers at primary photosynthesis acts is presented. ... Good agree ment between model yield and experimental 150 fe mtosecond oscillations achieved. A set of numerical experiments for different regimes of electron transport was realized. Diploma also contains a comparison between different model approaches using to describe electron transport. ...

Еще в разделе: (Показать все результаты (>110) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2014/Ksenofontov_Savelev_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2015/Semenov_Shlenov_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2007/Rumiantsev_Shmalgauzen_en.pdf

... Announcement of the Availability of the LSI Logic International Services Scholarship to Post-Graduate Students of Moscow State University and Moscow Institute of Physics and Technology . ... Interested applicants should submit the following documents not later than September 26, 2003 : . ... LSI Logic International Services is wholly own subsidiary of LSI Logic Corporation, Milpitas, California. ... LSI is headquartered at 1621 Barber Lane, Milpitas, CA 95035. ... LSI Logic . ...

Еще в разделе: (Показать все результаты (>112) - www.mmonline.ru/ )

• MMOnline | Аспирантура | Стипендия LSI Logic для аспирантов МГУ
• MMOnline | Новости | Стипендия LSI Logic для аспирантов МГУ
• MMOnline | Форумы | Аспирантура | Аспирантура в Порту, Португалия

... Выпускники . ... The blood test is, when you think about it, a remarkable thing. ... Blood becomes data, and in these numbers lies knowledge about your current health, your risks for disease, and your potential response to treatment. ... The typical blood test report is an exercise in obfuscation, a document that needs to be translated by a lab technician or physician, and that's if you somehow manage to see a copy of your results. ... On the next few pages, Wired has given the lab report a makeover...

Еще в разделе: (Показать все результаты (>236) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: IN VITRO ВЛИЯНИЕ ОПЕРАТОРА ЦИГУН НА ИЗМЕНЕНИЕ
• Клуб выпускников МГУ: CRISIS IN THEORETICAL PHYSICS: THE PROBLEM OF SCIENTIFIC

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>4) - npidb.belozersky.msu.ru/ )

The laboratory runs currently several scientific projects aimed at the foundations of quantum information science (the theories of quantum measurement and entanglement, design and analysis of quantum cryptographic protocols, atoms dynamics in optical dipole trap, etc.), applications of quantum theory to modeling quantum interference phenomena in multilevel atoms interacting with optical and magnetic fields (dark resonance spectroscopy), and exploring ... Physics 96 (4), 629-642 (2003). ...

Еще в разделе: (Показать все результаты (>96) - qilab.phys.msu.ru/ )

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

136. tunka_graph

137. http://sbmg.geol.msu.ru/polinf/comunits/help.htm

138. TAJIKISTAN FY 2011тАУ2015 Multi-Year Strategy | ECFS

139. http://www.prof.msu.ru/eng/info/Application%20instructions.doc

140. http://www.imk.msu.ru/Structure/Linguistics/yakubovich/download/Hieroglyphs.pdf