... For the past years I have been working on the problem of synthesis of light curves of close binary systems, consisting of a normal star and a compact object (point object with fixed X-ray luminosity). ... Possible existence of a bright spot on the disk's lateral surface is taken into account. ... The last of then will be published in Gordon and Breach Publishers ( Cherepashchuk A.M., Katysheva N.A., Khruzina T.S., Shugarov S.Yu. ... Cherepashchuk A.M., Katysheva N.A., Khruzina T.S., Shugarov S.Yu. ...

Еще в разделе: (Показать все результаты (>43) - uranus.sai.msu.ru/ )

... All rights reserved 0006-3509/96 $24.00+ .00 PH: 80006-3509(96)00171-8 TYPES OF NON-LINEAR BEHAVIOUR OF THE SYSTEM OF ION TRANSFER ACROSS THE MEMBRANE ON EXPOSURE TO A WEAK ELECTRIC FIELD* · 1 · T. Yu. ... L.- x Fig. ... Changes in the concentration of protons in response to external periodic perturbation external action A = 0.003 and critical frequency frequencies, periodic oscillations take place, x and potassium ions y in the near-membrane layer by a weak electric field. ...

Еще в разделе: (Показать все результаты (>37) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/PDF/3334.pdf
• http://library.biophys.msu.ru/PDF/3345.pdf
• http://library.biophys.msu.ru/PDF/3340.pdf

... Linguistic expeditions . ... Logical and stylistic aspects of lexical semantics . ... Linguistic phenomena can be approached and described from various perspectives. ... The approach proposed here is distinctive in that it is based on logic and stylistics, which are usually considered marginal to the description of linguistic phenomena. ... A special focus in the present approach on parallel texts is directly connected with translation . ...

Еще в разделе: (Показать все результаты (>26) - lcl.srcc.msu.ru/ )

... Supercomputing Technologies in Science, Education and Industry Almanac Series . ... Octotron: Active Control for Reliable Functioning of Supercomputers . ... DiMMon: a New Approach to Supercomputer Monitoring . ... X-COM: Distributed Computing Software . ... We propose a new approach to building distributed modular monitoring system named DiMMon, both for current and future systems, with an extremely high degree of parallelism. ... Research Computing Center (RCC) of Lomonosov Moscow State University...

Еще в разделе: (Показать все результаты (>68) - hpc.msu.ru/ )

• APPLICATIONS: Structure and Dynamics of Atomic-Molecular Systems | Moscow
• CLEO: USER & ADMIN-FRIENDLY CLUSTER BATCH SYSTEM | Moscow University
• Welcome to HPC.MSU.RU! | Moscow University Supercomputing Center

... CLEANSOIL . ... Therefore, the system is applicable to the remediation of soil below buildings, roads, pipelines, railroads, etc, for both local and/or diffuse contamination, and even for preventive applications. to develop and to test an innovative, simple, easy to handle, applicable under existing infrastructures and cost-effective on-site and in-situ soil remediation method able to achieve a degree of soil remediation that allows its reutilisation for different purposes; . ... http://soil.msu.ru ...

Еще в разделе: (Показать все результаты (>8) - eco.soil.msu.ru/ )

PHYSICAL REVIEW A VOLUME 56, NUMBER 4 OCTOBER 1997 Multiple ionization of atoms and molecules in collisions with fast ions: Ion-atom collisions N. M. Kabachnik,1,* V. N. Kondratyev,1,2, Z. Roller-Lutz,1 and H. O. Lutz1 2 ЕЕ Е Fakultat fur Physik, Universitat Bielefeld, D-33615 Bielefeld, Germany Advanced Science Research Center, Japan Atomic Energy Research Institute, Tokai, Naka, Ibaraki 319-11, Japan Received 27 May 1997 A theoretical description of multiple ... Methods Phys. Res. ...

Еще в разделе: (Показать все результаты (>96) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/LIIWM/physscr_64_2001_53Khodyrev.pdf
• http://danp.sinp.msu.ru/LAS/Nimb212_03_96Teplova.pdf
• http://danp.sinp.msu.ru/LIIWM/ArXiv-0904.2151v1_Khodyrev2009.pdf

HERMITE FUNCTIONS EXPANSION BASED NON-LOCAL MEANS ALGORITHM FOR CT-APPLICATIONS1 N. Mamaev2, A. Lukin3, D. Yurin4, M. Glazkova5, V. Sinitsin6 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia mamaev.nikolay93@mail.ru, 3lukin@ixbt.com, 4yurin@cs.msu.ru 5,6 Federal Center of Medicine and Rehabilitation Ivan'kovskoye sh., ... Noise in CT-images is close to Gaussian [3]. ...

Еще в разделе: (Показать все результаты (>7) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.su/~yurin/Doxyfile

... Quick Links ------------------------------- Address Laboratory now Equipment Administration Staff Web-pages Workgroups pages Phone-book, e-mail News Research Grants Publications Education Site Search . The Laboratory of Catalysis and Gas Electrochemistry (CGE) was organized in 1947 on the basis of the Laboratory of Inorganic Catalysis which existed on the Department of Chemistry since 1931. ... Copyright 2001, Laboratory of Catalysis and Gas Electrochemistry, Web-design A.N. Kharlanov. ...

Еще в разделе: (Показать все результаты (>17) - www.kge.msu.ru/ )

... Next Routine] [List of Routines] NAME: ADD_HEADER PURPOSE: addition information from FITS-headers MPFS-frames DESCRIPTION: The function computes the total exposure, mean value zenit distance and modified FITS header CALLING SEQUENCE: Result =ADD_HEADER( headers ) CATEGORY: reduction MPFS-data INPUTS: Headers = String array FITS-headers from the MPFS data OUTPUTS: Header = String array containing the header from the FITS file. ... OPTIONAL INPUT KEYWORD PARAMETERS: BEFORE = Keyword string name. ...

Еще в разделе: (Показать все результаты (>46) - sn.sai.msu.ru/ )

... Distribution of neutron counting rate near the Earth surface is studied in two directions - to the Earth and from it - according experimental data, obtained in Moscow in 1996. ... We suppose that logarithmically normal distribution describes an input of the Earth crust into the neutron flux. ... Usual periods . ... Full approximation of thermal neutrons distribution near the Earth crust is presented as a sum of two functions - Poison distribution and logarithmically normal distribution. ...

Еще в разделе: (Показать все результаты (>223) - www.kosmofizika.ru/ )

• Index of /lazutin

LOCAL TSUNAMI WARNING AND MITIGATION ________________________________________________________________________________________________________________________________________ PROBABILISTIC ANALYSES OF LANDSLIDE TSUNAMI HAZARDS Philip Watts Applied Fluids Engineering, Inc., ... Throughout the Pacific, tsunami amplitude and earthquake magnitude records acquired during the 1990s suggest that submarine mass failures generate the maximum tsunami amplitude in around 30% of events [Watts, 2002]. ...

Еще в разделе: (Показать все результаты (>21) - seac47-2.phys.msu.ru/ )

• http://seac47-2.phys.msu.ru/proc/Recommendations.pdf
• LOCAL TSUNAMI WARNING AND MITIGATION -- Proceedings Download Page

Literature . ... Computers and Statistical Data Analysis. ... In Russian. ... Basic notions and methods of applied statistical analysis and usage of leading Russian and American statistical software tools: STADIA, STATGRAPHICS. ... The second edition has much more detailed depiction of temporal series analysis methods, review of statistical packages for Windows and recommendations on their choosing. ... Kulaichev A.P. Data Analysis Methods And Tools for Windows . ... In English and In Russian. ...

Еще в разделе: (Показать все результаты (>2) - statsoft.msu.ru/ )

Electron Paramagnetic Resonance Plan (1) Principle of the EPR method (a) history of the EPR method discovery (b) mechanic and magnetic moments of electron (c) Zeeman's effect (d) resonance basic equation (2) EPR spectra characteristics (a) amplitude (b) line shape (c) line width (d) superfine structure (3) Scheme of an EPR radiospectrometer (4) EPR application in medical biological investigations (e) natural ... Among such radicals, nitroxyl radicals became the most popular. ...

Еще в разделе: (Показать все результаты (>30) - foroff.phys.msu.ru/ )

• http://foroff.phys.msu.ru/illposed/programs/Listing_03.txt
• http://foroff.phys.msu.ru/phys/med/engl_ver/evc_02ft.pdf
• Postdoctoral training (Neutronography)

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>155) - www.pereplet.ru/ )

Calcareous paleosols are widely distributed throughout the arid and semi arid regions of the world. These paleosols have been described from virtually every continent of the world, yet there is no internationally agreed upon nomenclature for the description of the horizons present within them. ... This abstract proposes the adoption of a universally agreed-upon system of horizon designation and gross morphological description of calcareous paleosols. ... Soil Science, 101, 347-360. ...

Еще в разделе: (Показать все результаты (>266) - www.fadr.msu.ru/ )

• Foundation for Agrarian Development Research - Services - Portfolio
• Abstracts
• NEW FARM RESOLUTION (From RUSAG conference)

The purpose of the space-physics lab exercises is to introduce the students to the methods of the measurements, to the modern conception of near-Earth space structure and the physical processes and phenomena occured in it. ... At present the reasearches and the teachers of the University and of other institutes participating in the project continue development of the the special space-physics lab exercises, and they are interested in your ideas concerning the future exercises. ...

Еще в разделе: (Показать все результаты (>42) - cosmos.msu.ru/ )

• University Satellites and Space Science Education '2006
• University Satellites and Space Science Education '2006 I

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... Полная версия этой страницы: Higgs boson lighter than previously predicted . Студенческий форум Физфака МГУ > Наука физика > Другое . ... The new W-mass value leads to an estimate for the mass of the yet-undiscovered Higgs boson that is lighter than previously predicted (<114 ГэВ, см. картинку ниже, доверительный интервал 68%) , in principle making observation of this elusive particle more likely by experiments at the Tevatron particle collider at Fermilab. ...

Еще в разделе: (Показать все результаты (>620) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > семинар Г. т'Хофта в Стекловке
• семинар Г. т'Хофта в Стекловке - Студенческий форум Физфака МГУ
• Студенческий форум Физфака МГУ > Как удалить себя из службы ICQ?

... Surkova G.V., Koltermann K.P., Kislov A.V. Method of forecasting storm conditions for the Black Sea under climate changes Mathematic modeling (climatic models or models of the Earth s climatic system) is used to forecast variations of the state of the environment under climate changes. ... Statistical data of storm conditions in a number of sites of the Black Sea coast was analyzed and their changes were forecasted for the middle of the 21st century under a specific scenario of climate warming. ...

Еще в разделе: (Показать все результаты (>175) - www.geogr.msu.ru/ )

• Instructions for Authors, contributing to “GEOGRAPHY, ENVIRONMENT,
• CONTENTS ?6 - 2011
• CONTENTS ?3 - 2009

... About 70 scientific papers. The theory of square parachute is created, describing distribution of parameters of shape, tension and resistance to airflow of canopy in steady-state condition for various sets of suspension line lengths and air-permeability. ... The practical recommendations for optimal parachute application are submitted. ... It is discovered experimentally that a character of pressure distribution for a square canopy depends on a particular choice of suspension line lengths. ...

Еще в разделе: (Показать все результаты (>6) - margaret.imec.msu.ru/ )

• Education
• Air-Permeability Influence on Pressure Distribution Character
• On Square Parachute Differential Equations