Ultrafast Faraday Rotation In Magnetophotonic Microcavities Alexandr I. Musorin1, Margarita I. Sharipova1, Artem V. Chetvertukhin1, Tatyana V. Dolgova1, M. Inoue2, Andrey A. ... Hibarigaoka- - Tenpakucho, Toyohashi, Aichi Prefecture 441-8122, Japan musorin@nanolab.phys.msu.ru Abstract: Femtosecond dynamics of Faraday effect in magnetophotonic microcavities is experimentally demonstrated by using polarization-sensitive correlation scheme ...

Еще в разделе: (Показать все результаты (>65) - nanolab.phys.msu.ru/ )

• Nanophotonics of surface states in photonic crystals | Laboratory of

... Basic statement: "Mathematics is much clever, than Mathematician" It means, that after the scientist or engineer developed new mathematical model and designed corresponding equations, the solution to these equations produces new information unpredictable for the author! ... This vibration excites the shear wave in tissue 2 sx 2 - (ct + ) s x = Fx 2 t t Studies in Fluid Dynamics of water jet are connected with two main problems: 1. Flows in contracting nozzle forming high-speed jet. ...

Еще в разделе: (Показать все результаты (>46) - acoustics.phys.msu.ru/ )

• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/trubochki.pdf
• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/prsla02.pdf
• http://acoustics.phys.msu.su/teachers/gusev_files/nano1.pdf

. Summary of experimental results . The light absorbing capacity of phytoplankton, estimated from Fo , and its photosynthetic activity (estimated as Fv/Fm ) are key characteristics of the primary processes of photosynthesis. We suggested a formula for calculation of the primary production of phytoplankton from these two characteristics and underwater irradiance. The probing data were used to plot vertical profiles of phytoplankton productivity in various regions of the Baltic, Norwegian, and South China

Еще в разделе: (Показать все результаты (>6) - www.biophys.msu.ru/ )

... Russian Pages . CDFE: Home Page . ... Numerical data, graphics, and bibliography . ... description] . Last updated: May 6th, 2014 . ... Last updated: June 15th, 2011 . ... Last updated: . ... Last updated: April 4th, 2015 . ... Last updated: February 25th, 2016 . ... Last updated: September 27th, 2011 . ... Photonuclear Data Index since 1955 . ... Last updated: September 15th, 2015 . ... Last updated: March 22th, 2010 . ... Last updated: March 19th, 2015 . ... Last updated: May 15th, 2002 . ...

Еще в разделе: (Показать все результаты (>18) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Nucleus Ground State Parameters
• CDFE => Online Services => Calculator and Graph Engine for Atomic Nuclei

Curriculum vitae Petr V. Paramonov Professor of Moscow State University 22 2011 . Surname: Paramonov Name: Petr Patronymic Vladimirovich Degrees: Candidate Phys.-Math. ... 1994: Submission and defence of doctoral dissertation "On conditions for approximability of functions by solutions of elliptic equations"(Steklov Institute of Mathematics). ... Paramonov P.V. and S uniform algebras., ... I. Mat.- ... Paramonov P.V., Interrelation of local and global approximations by holomorphic functions., ...

Еще в разделе: (Показать все результаты (>66) - new.math.msu.su/ )

• Control problems: theory and applications | Department: General Problems of

HERMITE FUNCTIONS EXPANSION BASED NON-LOCAL MEANS ALGORITHM FOR CT-APPLICATIONS1 N. Mamaev2, A. Lukin3, D. Yurin4, M. Glazkova5, V. Sinitsin6 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia mamaev.nikolay93@mail.ru, 3lukin@ixbt.com, 4yurin@cs.msu.ru 5,6 Federal Center of Medicine and Rehabilitation Ivan'kovskoye sh., ... Noise in CT-images is close to Gaussian [3]. ...

Еще в разделе: (Показать все результаты (>13) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.ru/files/courses/ipintro2012/Lec_Pt3_inpaint_my.pdf
• http://imaging.cs.msu.su/pub/2010.DSPA.Chernomorets_Nasonov_Krylov.BlinkEEG.en.pdf
• http://imaging.cs.msu.ru/pub/2013.PRIA.Levashov_Yurin.RidgeAndTree.en.pdf

... In vitro, the protein S7 of Thermus thermophilus is able to form complexes with both the minimal 16S rRNA fragment and the intercistronic region of the str operon mRNA from E.coli (Kd = 1.4x10-7 M and 1.1x10-7 M respectively). ... The filter binding assay. ... The most striking result of our study is that thermophilic protein S7 binds strongly to the E.coli S12-S7 intercistronic region of str mRNA in vitro, inspite of the lack of the functionally analogous thermophilic extended region. ...

Еще в разделе: (Показать все результаты (>7) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2002_1.pdf
• http://rnp-group.genebee.msu.su/pdfs/article_vas_bioelectro.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/nar2004.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

... Conferences . ... http://gct.math.nsc.ru/?event=metric-structures-and-control-systems . International Conference METRIC STRUCTURES AND CONTROL SYSTEMS will take place in Sobolev Institute of Mathematics, Novosibirsk, Russia, December, 17 ? ... The conference is organizing by the Laboratory of Geometric Control Theory of the Sobolev Institute of Mathematics (SB RAS) within the framework of the Project ?Geometric Control Theory and Analysis on Metric Structures?. ...

Еще в разделе: (Показать все результаты (>105) - ics.org.ru/ )

... Et maintenant qu'il faut partir, On a cent mille choses Ю dire, Qui tiennent trop Ю coeur pour si peu de temps., On s'est aimИ comme on se quitte, Tout simplement sans penser Ю demain, A demain qui vient toujours un peu trop vite, Aux adieux qui quelque fois se passent un peu trop bien. ... Allons petite il faut partir, Laisser ici nos souvenirs, On va descendre ensemble si tu veux, Et quand elle va nous voir passer, La patronne du cafИ, Va encore nous dire "Salut les amoureux". ...

Еще в разделе: (Показать все результаты (>10) - optics.sinp.msu.ru/ )

... PhD . ... Home News PhD defence . ... The title of the research project is  "Chemical and phase equilibria in the systems composed of 18-crown-6, water, sodium chloride and 1(2)-butanol" . Colloquium on 28.10.10 . ... Colloquium on 24.12.12 20 Dec 2012 . ... Colloquium on 23.11.12 22 Nov 2012 . ... Lomonosov Moscow State University . Department of Chemistry . ... Division of Physical Chemistry . Laboratory of Chemical Thermodynamics . ... 2000-2016 Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>9) - td.chem.msu.ru/ )

• PhD Defence Laboratory of Chemical Thermodynamics
• Lora S. Nikolaeva Laboratory of Chemical Thermodynamics
• Education Laboratory of Chemical Thermodynamics

... The subjects of the Colloquium-458 cover important problems dealing with the verification of constitutive equations, the organization of experiments, the connection between microstructures and mechanical properties and the effective utilization of the modern FEM packages. ... Institute of Mechanics, Lomonosov Moscow State University, Michurinsky Prospekt, 1, 117192, Moscow, Russia . ... S.-Petersburg, 195251, Russia. ... Institute for Problems in Mechanics of Russian Academy of Sciences . ...

Еще в разделе: (Показать все результаты (>3) - www.imec.msu.ru/ )

• EUROMECH Colloquium-458

Announcement On November 2-3, 2005 Lomonosov Moscow State University will conduct jointly with the Academy of Cryptography of the Russian Federation the Fourth All- Russian Conference Mathematics and Security of Information Technologies [Cybersecurity?] and jointly with the Center of International Studies, Cambridge University , United Kingdom, Advanced Research Workshop Unconventional ... Sherstyuk V.P. - Security Council of the Russian Federation; 3. ... Organization Committee 1. ...

Еще в разделе: (Показать все результаты (>16) - suny.msu.ru/ )

• http://suny.msu.ru/ru/ProgramMaBIT05En.doc

Lomonosov Moscow State University | pic] |Faculty of Biology | ... Application | ... Name | ... First Name | ... Other Names | ... Date of Birth | ... Place of Birth | ... Passport | ... Passport issued | ... City | ... 2.|e-mail | ... Faculty | ... Russian Consulate to be applied to for visa[1] |10.| City, state | ... The visa invitation supposes your stay in Moscow and a region adjacent to WSBS ONLY. ... 1] Cannot be changed after application ...

Еще в разделе: (Показать все результаты (>6) - www.bio.msu.ru/ )

• Master In Ecology ? Биологический факультет МГУ

Information letter Dear colleagues! Faculty of Basic Medicine, Lomonosov Moscow State University and State Research Center ґ Institute for Biomedical Problems, Russian Academy of Science would like to invite you to participate in the work of the VII Russian National School with International Participation on Muscle and Exercise Physiology ?New approaches to studying of classical problems?. ... Abstracts of reports will be published. ... The receipt of your abstract will be confirmed by e-mail. ...

Еще в разделе: (Показать все результаты (>12) - www.fbm.msu.ru/ )

... List of complexes . List of structures of RNA-protein and DNA-protein complexes . ... Experimental method: all X-RAY DIFFRACTION SOLUTION NMR ELECTRON MICROSCOPY FIBER DIFFRACTION SOLUTION NMR; THEORETICAL MODEL SOLUTION NMR; SOLUTION SCATTERING . Kind: all rna dna hybrid . ... HYDROLASE/DNA . X-RAY DIFFRACTION . ... dna . ... RNA BINDING PROTEIN/RNA . ... rna . ... HYDROLASE/RNA/DNA . ... HYDROLASE/RNA . ... TRANSFERASE/RNA/DNA . ... TRANSFERASE/DNA/RNA . ... NPIDB team 2003 - 2016 . ...

Еще в разделе: (Показать все результаты (>16) - npidb.belozersky.msu.ru/ )

• NPIDB: Home

... ICONO Invited Speakers . ... Gennadiy Kulipanov, Budker Inst. of Nuclear Physics, Russia . ... Marlan Scully, Texas A&M Univ., ... Andrey Goncharov, Inst. of Laser Physics, Russia . ... Vladimir Trunov, Inst. of Laser Physics, Russia . ... Since 1987, he has worked at the National Research Council of Canada (Ottawa) in the field of laser physics and trapped ion optical frequency standards. ... Alexey Taichenachev , Inst. of Laser Physics, Russia . ... S. Vatnik, Inst. of Laser Physics, Russia . ...

Еще в разделе: (Показать все результаты (>6) - iconolat13.phys.msu.ru/ )

• Guidelines

... Полная версия этой страницы: про нердов =) . Студенческий форум Физфака МГУ > Общий > Все обо всем > Мальчики-девочки . ... А припев там - Im jsut 2 white and nerdy "Я просто белый ботан.." или "Я просто белый, нудный))))" . ... I know they're all thinking . I'm so White N' nerdy . Think I'm just too white n' nerdy . ... Can't you see I'm white n' nerdy . Look at me I'm white n' nerdy! ... I'm too white n' nerdy . ... I'm just too white n' nerdy . ... Just because I'm white n' nerdy . ...

Еще в разделе: (Показать все результаты (>1274) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > Новая версия форума 2.3.1
• Студенческий форум Физфака МГУ > Write in English
• Студенческий форум Физфака МГУ > Каррент мьюзик

Create user account [Комиссия, 3 семестр, 2014-2015] . ... Use an existing account . To create an account, please think out, a login and provide your valid e-mail address in the form above. ... This contest operates in \"simplified registration\" mode. ... Accounts created using simplified registration procedure cannot be used for participation in contests, which do not allow simplified registration. If you want a regular account, you may create an account using the regular registration . ...

Еще в разделе: (Показать все результаты (>12) - acm.msu.ru/ )

• Create user account [Комиссия, 4 семестр, 2014-2015]
• Create user account [ACM ICPC 2015-2016, NEERC, Moscow Subregion, Training]
• Create user account [а?аИа?а? 2015 (аЕаЕаВаАб?б?аОаПаОаЛб?)]

IEEE Transactions on Computational Intelligence and AI in Games (Special Issue on Brain/Neuronal-Computer Games Interfaces and Interaction), 2013, in press. ... Adapting the P300-based brain-computer interface for gaming: a review Alexander Y. Kaplan, Sergei L. Shishkin, Ilya P. Ganin, Ivan A. Basyul, and Alexander Y. Zhigalov Abstract--The P300-based brain-computer interface (P300 BCI) is currently a very popular topic in assistive technology development. ... Neurophysiol ., vol. 113, pp. ...

Еще в разделе: (Показать все результаты (>57) - brain.bio.msu.ru/ )

• Analysis of change-point synchronization in multi-channel EEG
• Spatial synchronization of the change-points
• Change-points in EEG components with different pattern