Research topics . ... This group is formed to study the reactions at semiconductor surfaces. ... Group members: . ... M.V. Lomonosov Moscow State University: . ... Dr. Tatiana S. Zyubina, senior scientific researcher (quantum chemical modeling) . ... Joint Semiconductors Surface Study group: research sketches . The Joint Semiconductors Surface Study (JSSS) group was developed on the base of Inorganic Chemistry division, Chemistry dept. of M.V. Lomonosov Moscow State University. ...

Еще в разделе: (Показать все результаты (>45) - www.inorg.chem.msu.ru/ )

... The Department of Operations Research . ... Coordinators Contacts . ... on Operations Research, . ... Moscow, April 10-14, 2007 Coordinators . ... 1) New models and methods . Prof. V.V. Morozov . ... 3) Multiple objective decision making . ... Prof. I.G. Pospelov, Prof. A.A. Shananin . ... Prof. A.A. Belolipetckiy . ... 9) Game-theoretic models . ... Symposium A: Analysis of the markets and decision making in electric power industry . ... Symposium B: Models of political decision making. ...

Еще в разделе: (Показать все результаты (>3) - io.cs.msu.ru/ )

• Traditional topics of the conference - ORM 2007

... Noise and stability analysis of scanning tunneling microscope is performed, outer and inner noise sources are described. ... Comprehensive bibliography on scanning probe microscopy methods (1981-1997) is composed. ... FemtoScan Online microscope with Internet control - the first probe microscope with full remote access. ... Ideology for FemtoScan Online software for sophisticated 3D image analysis in scanning probe microscopy and related fields. ...

Еще в разделе: (Показать все результаты (>97) - www.spm.genebee.msu.ru/ )

• Denis Igorevich Trofimov
• AFM studies of DNA condensation

обзор! astro-ph/0207223 . ... Author: Sultana N. Nahar . Comments: 15 pgs., 5 color figs., ... Comments: 46 pages including 16 figures, uses eas.cls, to appear in the proceedings of the Aussois 2001 summer school "Stades Ultimes de l'Evolution Stellaire", EAS Pub. ... Comments: 26 pages, 5 figures, submitted to ApJ . ... Commets: 5 pages, 4 figures, to appear in: Pis'ma v Astronomicheskii Zhurnal, 2003, v.29, No.2, p111-115 and will be translated as: Astronomy Letters, v.29, No.2, p.91-95 . ...

Еще в разделе: (Показать все результаты (>364) - astro.uni-altai.ru/ )

• http://xray.sai.msu.ru/~polar/sci_rev/2002-07_2003_03/sun.html
• Новости науки

... Студенческая Астрономическая обсерватория ГАИШ . ... Структура ГАИШ : Отдел внегалактической астрономии : . ... For those really interested in galaxies, extragalactic astronomy or the aspects of cosmology we study, we can always find an interesting problem to work on. ... To make your work in the Group most effective, it would be useful to study the following courses read by our group members as well as the members of other groups in our and other institures. ... Student information . ...

Еще в разделе: (Показать все результаты (>18) - www.sai.msu.ru/ )

... if (B1) { S1; } if (B1) { S1; } if (B2) { S2; } - - ...exp... int x = 1; if (x == 1) { std::cout << "Okay" << std::endl; } else { std::cout << "Error" << std::endl; } -- ґ int strlen(const char* p) { int len = 0; do { ++len; } while (*p++); return len; } ??, ?bbb? -- , : Ї ґ , , Ї ґ , , Ї ґ , Ї ґ . ... 1977 ґ LTL, Ї , 1981 ґ (CTL), Ї , , 1981 , , 1982 ґ model checking ( ), Ї , 1986 ґ model checking ( ), Ї , 1989 ґ SPIN. ... The Spin Model Checker: Primer and Reference Manual, Addison Wesley, 2003. ...

Еще в разделе: (Показать все результаты (>2) - savenkov.lvk.cs.msu.su/ )

... Kirk Hatfield . ... J. Hydrol. In Review). Klammler H., K. Hatfield, and M. Annable. ... Newman, M., K. Hatfield, J. Hayworth, P.S.C. Rao, and T. Stauffer. ... Hatfield, K., M. Annable, J. Cho, P.S.C. Rao, and H. Klammler. ... Brooks, M., M. Annable, P.S.C. Rao, K. Hatfield, J. Jawitz, W. Wise, A. Wood, C. Endfield. ... Brooks, M.C., M.D. Annable, P.S.C. Rao, K. Hatfield, J.W. Jawitz, W.R. Wise, A.L. Wood, and C.G. Enfield. ... Hatfield, K., M.D. Annable, S. Kuhn, P.S.C. Rao, and T. Campbell. ...

Еще в разделе: (Показать все результаты (>119) - mgumus.chem.msu.ru/ )

• MGUMUS -- Current projects
• MGUMUS -- First International Conference on Humics-based Innovative
• MGUMUS -- Первая международная конференция по гуминовым инновационным

MSU . Science Park . ... Prototyping center . Engineering formula . ... Center for Youth Innovation Creativity and Prototyping at Moscow State University Science Park is focused on work with pupils and students to familiarize them with the capabilities of modern equipment and engaging in scientific and technical activities. ... The main goal of the Center - provide opportunities for children and young people to fulfill themselves in scientific and technical work. ... JSC "MSU Science Park" . ...

Еще в разделе: (Показать все результаты (>7) - www.sciencepark.ru/ )

... WORKSHOP "STELLAR ATMOSPHERES" . THE CHEMICAL AND DYNAMIC EVOLUTION OF STARS AND GALAXIES" . ... Chernomorka , Odessa , Ukraine . ... Modeling and interpretation of the stellar spectra of the usual and peculiar stars. Elemental abundances in the stars of different types and populations of the Galaxy. Chemical evolution of the stars and galaxies. ... Andrievsky S.M. (OAO ONU, Odessa, Ukraine) . ... CHEMICAL and DYNAMIC EVOLUTION STARS and GALAXIES" . ... Odessa mailto:astro@paco.odessa.ua . ...

Еще в разделе: (Показать все результаты (>62) - sai.msu.ru/ )

• Astronomical and Astrophysical Transactions

Alexander S. Antonov . ... M.V.Lomonossov Moscow State University . ... June 4, 1999, Moscow State University . ... 1994-2000: programmer, Laboratory of Parallel Information Technologies, Research Computer Center, Moscow State University . ... A.S. Antonov, A.M. Teplov. ... Antonov A.S., Voevodin Vl.V., Sobolev S.I., Filamophitskiy M.P. Internet-Auditorium of Lomonosov Moscow State University // Abstracts of the All-Russian scientific conference "Scientific Services Internet" (Novorossiysk, 2000). ...

Еще в разделе: (Показать все результаты (>12) - asa.guru.ru/ )

О кафедре . История кафедры . ... Международные и внутри-российские связи кафедры . ... Олимпиада кафедры . Наглядная и компью терная геометрия и топология . ... список публикаций в.л.голо (январь 2008) PDF-file . ... Teor. ... 13] Currents in superfluid 3 He (with M.I.Monastyrskii), Lett. ... Phys. 2, 379 (1978). ... 34] Chaos and long-lived modes in dynamics of liquid crystals (with E.I.Kats and A.A.Leman), Zh. ... 38] Slow modes in spin dynamics of superfluid 3 He?B (with E.I.Kats), Zh. ...

Еще в разделе: (Показать все результаты (>59) - dfgm.math.msu.su/ )

• Носовский Г.В. / Кафедра Дифференциальной геометрии и приложений /
• Conference dedicated to the memory of Professor Yu. P. Solovjev
• Titles of talks

Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...

Еще в разделе: (Показать все результаты (>115) - mouse.belozersky.msu.ru/ )

• Index of /npidb/pdb
• wLake program homepage

... 2012. Vaughan, W. Digital Modelling, 2012. ... Heritage, G.L., Large, A.G. Laser scanning for the Environmental Sciences. 2009. ... Ikeuchi, K., Miyakzaki, D. Digitally Archiving Cultural Objects. 2008. ... Digital Human Modelling: Third International Conference, ICDHM 2011, Held at FL, USA, July 9-14 2011.Springer. ... 2010. ...

Еще в разделе: (Показать все результаты (>26) - www.anthropos.msu.ru/ )

XXIII ICTAM, 19ґ24 August 2012, Beijing, China CASES OF INTEGRABILITY IN DYNAMICS OF A RIGID BODY INTERACTING WITH A RESISTANT MEDIUM Maxim V. Shamolin Institute of Mechanics, Lomonosov Moscow State University, Moscow, 119899, Russian Federation Summary The author discovers new integrable cases of the rigid body motion in a resisting medium, including those in the classical problem of motion of a spherical pendulum placed in the over-running medium flow. ...

Еще в разделе: (Показать все результаты (>62) - shamolin2.imec.msu.ru/ )

• http://shamolin2.imec.msu.ru/art-164-1.pdf
• Заседание 320 (совместное заседание с семинаром механико-математического
• Mathematical Reviews

Roman Sutormin rsutormin@gmail.com Professional experience 05/2013 ґ present: Lawrence Berkeley National Laboratory (Berkeley, CA, USA) Software developer Development of JSON based storage system used for keeping biological data involved in public KBase services. ... 10/2009 ґ 08/2011: Mail.Ru Group (Moscow, Russia), Software developer Support and development of data warehouse (PostgreSQL) and administration web tool (JBoss + GWT) on serverside of MMO game "Allods Online". ... 2013 Jul 1514(1):476. ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf

... Master Degree in Geology . Master Degree in Management . Master Degree in Chemistry . ... 29 марта 2016 г. День открытых дверей Высшей школы инновационного бизнеса . ... T he goal of this Master Degree program is to educate specialists with the knowledge of the newest technologies of geological study, modeling and development of deposits, advanced scientific methods of seismic and geophysical exploration, geophysical well-logging, production enhancement, etc. ...

Еще в разделе: (Показать все результаты (>5) - www.hsib.msu.ru/ )

... О кафедре . ... КРИВОНОЖКО Владимир Егорович (11.06.1948, г. Москва) д.физ.-мат.н., профессор МФТИ, зав. кафедры АСУ МИСИС. ... Krivonozhko V. E., F rsund F. R. Lychev A. V. Terminal units in DEA: Definition and Determination // University of Oslo. ... F rsund F. R., Krivonozhko V. E., Lychev A. V. Hidden Effects in DEA Models //Differential Equations. ... Krivonozhko V. E., F rsund F. R., Lychev A. V. Some Ulterior Effects in the DEA models // Abstracts of the INFORMS Annual Meeting. ...

Еще в разделе: (Показать все результаты (>7) - ndsipu.cmc.msu.ru/ )

Gamma-quanta from SNRs V.N.Zirakashvili Pushkov Institute of Terrestrial Magnetism, Ionosphere and Radiowave Propagation, Russian Academy of Sciences (IZMIRAN), 142190 Troitsk, Moscow Region, Russia Outline Ї Acceleration of particles at forward and reverse shocks in SNRs Ї Amplification of magnetic fields Ї Modeling of broad-band emission Ї Radioactivity and electron acceleration Diffusive Shock ... 2010) . ... Cosmic ray positrons can be accelerated at reverse shocks of SNRs. ...

Еще в разделе: (Показать все результаты (>7) - tunka.sinp.msu.ru/ )

• http://tunka.sinp.msu.ru/en/presentation/Ptuskin.pdf

Information Security Meeting Schedule Thursday, March 30 12:00 noon Opening and Catered Lunch 1:00 R. Sekar, Stony Brook University - Ongoing Research at Secure Systems Laboratory at Stony Brook University 1:30 Scott Craver, Binghamton University - Information Hiding and Counterdeception 2:00 Sanjay Goel, University at ...

Еще в разделе: (Показать все результаты (>8) - suny.msu.ru/ )

... Oxidative stress induced in rat brain by a combination of 3-nitropropionic acid and global ischemia. ... Combination of global ischemia induced by 3-vessel occlusion of major arteries supplys rat brain and subsequent 5-day reperfusion with intraperitoneal injection of 3-nitropropionic acid induces vigorous oxidative stress in brain tissues accompanied by evident neurological symptoms in Wistar rats. ...

Еще в разделе: (Показать все результаты (>65) - biochem.bio.msu.ru/ )

• Human pro-B-type natriuretic peptide is processed in the circulation in a rat
• [Search for chaperon-like anticataract drugs, the antiaggregants of lens
• Expression of NMDA receptors in multipotent stromal cells of human adipose