Experimental Collaborations . Leading particles" -- E852 -- CMS -- "The Hall D Project" . Scintillation Magnetic Spectrometer MSU": experimental setup . ... fixed target experiment to trace the evolution of transient non-equilibrium hadronic states, as they penetrate through the nuclear matter . an experiment in the polarized proton beam to investigate spin phenomena in the proton-nucleus interactions . ... Participants from Hadronic Interactions Laboratory: . ...

Еще в разделе: (Показать все результаты (>50) - lav01.sinp.msu.ru/ )

• Etapi- Comments 3/1/97
• ASI "Structure and Dynamics of Elementary Matter", September 21 - October 2,

... Only by numerical simulation. ... moment T (K) Dipole moment (D) Experiment Other example: Diffusion constant 200 250 298 350 400 2.40 2.37 2.48 2.59 2.80 2.25 The Distribution functions: radial distribution function 1 g (r) = N t =1 j i N TS N pair ( r - rij ) The Distribution functions: radial distribution function CC def 2 Work mode ґ computer related 1) Ї Perform simulation , create trajectory file Ї Calculate properties timestep by timestep 2) Ї Perform ...

Еще в разделе: (Показать все результаты (>23) - www.elch.chem.msu.ru/ )

• http://www.elch.chem.msu.ru/mole/lecture/qfeldman.pdf

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>170) - tukachev.flogiston.ru/ )

• Category: Новости

... The linguistic aspects of the model and the properties of the semantic dictionary ensuring the content analysis with compression of the text structure are considered. Our dictionary resources serve an instru- ment for building a multilevel textual semantic structure. ... Reason (A,B), where SemF(A) = SIT or a whole semantic formula; the same for SemF(B). ... Sem(SIT)R . ... Semantic Resources for Textual Content Compression // Fourth International Conference on Meaning-Text Theory (MTT'09). ...

Еще в разделе: (Показать все результаты (>4) - leontyeva.srcc.msu.ru/ )

• Lexical Resources for Personal Data Recognition in Texts

... What are mechanisms of secular evolution? ... Internal mechanisms of secular evolution may b e: Ї bar instabilities in dynamically cold disk galaxies , Ї deviations from circular rotation due to non-axisymmetric gravitation p otential effect which may b e produced by planar structures ... gravitational and energetic, effects of nuclear sup ermassive black holes ґ they may provoke as attraction as well expansion, Ї certain gas expansion by galactic winds and fountains, etc ...

Еще в разделе: (Показать все результаты (>49) - sn.sai.msu.ru/ )

• MPFS reduction routines HELP
• Olga Silchenko

... Department of Electrical and Computer Engineering, University of Toronto, 10 King's College Road, Toronto, Ontario, Canada M5S 3G4 (Received 14 October 2003; published 20 May 2004) We consider the interaction and stability of gap solitons in a one-dimensional, resonant, photonic crystal with a defect state produced by a linear localized mode, or by an incoherent pump. ... This is consistent with the physical meaning of the linear localized mode. ... Phys. Rev. Lett. ... Lett. ... Phys. Lett. ...

Еще в разделе: (Показать все результаты (>39) - genphys.phys.msu.su/ )

• http://genphys.phys.msu.su/rus/sci/photonics/PDF/2.pdf
• http://genphys.phys.msu.su/rus/sci/photonics/PDF/JETP56.pdf
• http://genphys.phys.msu.su/rus/sci/photonics/PDF/5.pdf

Variety of Long-Eared Owls (Asio otus L.) Diet as Index of Habitats Usefulness. ... Owls draw to themselves attention, due to a number of such features, as a wide circulation practically in all natural zones, an originality of ecology, behavior and morpho-physiology; prospect synantropisation some species on a background of disturbing decrease in number of others, difficultly observable and, still, poorly studied. ... Adult owl brings young sparrow from birddealer to his fledgling. ...

Еще в разделе: (Показать все результаты (>70) - vertebrata.bio.msu.ru/ )

• http://vertebrata.bio.msu.ru/Sokolov2.pdf
• Vladimir V. Shakhparonov

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>8) - npidb.belozersky.msu.ru/ )

• NPIDB: 5DPK structure

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/jbcb_2006.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/genome_biol_evol_2014.pdf

... 01509 22 2561 Fax 01509 22 3925 Email Stephen.Fletcher@Lboro.ac.uk Keywords SchrЖdinger Equation, Golden Rule, Butler-Volmer Equation, Tafel Slopes, Electron Transfer. ... In the case of electron transfer, we may imagine a transition between two well-defined electronic states (an occupied state D inside an electron donor D, and an unoccupied state A inside an electron acceptor A), whose mutual interaction is weak. ... where U D , the single energy of the donor state, is a constant. ...

Еще в разделе: (Показать все результаты (>88) - electr003.chem.msu.ru/ )

• http://www.elch.chem.msu.ru/rus/alekseeva.pdf
• http://nanofluidics.phys.msu.ru/paper/faraday2013.pdf
• http://www.elch.chem.msu.ru/kuznetsov/rje2008.pdf

... Biol. (2001) 212, 275 } 294 doi:10.1006/jtbi.2001.2375, available online at http://www.idealibrary.com on Light-triggered pH Banding Pro5le in Chara Cells Revealed with a Scanning pH Microprobe and its Relation to Self-Organization Phenomena A. A. BULYCHEV*, A. A. POLEZHAEV-, S. V. ZYKOV?A, T. YU. ... When exposed to light, internodal cells of Chara and Nitella develop a pattern of alternating acid and alkaline bands along the cell length (Spear et al., ... LIGHT-CONTROLLED PATTERNS FIG. ...

Еще в разделе: (Показать все результаты (>39) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/matorin/3388.pdf
• http://library.biophys.msu.ru/matorin/3398.pdf
• http://mgumus.chem.msu.ru/publication/2006/perminova-mediating.pdf

SELECT data_key, data_value FROM xf_data_registry WHERE data_key IN ('options', 'languages', 'contentTypes', 'codeEventListeners', 'cron', 'simpleCache', 'routesPublic', 'bannedIps', 'styles', 'nodeTypes', 'smilies', 'bbCode', 'displayStyles', 'trophyUserTitles', 'reportCounts', 'moderationCounts') . ... Select Type . ... Ref . ... SIMPLE . ... PRIMARY . ... const . ... library/XenForo/ Autoloader.php . ... library/Zend/Registry.php . ... library/Zend/Config.php . ... library/Zend/Db/Select.php . ...

Еще в разделе: (Показать все результаты (>26) - osk.msu.ru/ )

• http://osk.msu.ru/forum/members/adollekautoto.2142/?_debug=1
• http://osk.msu.ru/forum/members/arbimeorirm.2192/?_debug=1
• http://osk.msu.ru/forum/members/catyfopwbex.2168/?_debug=1

... These approaches were: (1) laser photobleaching of a path through the centrosome; (2) direct observation of microtubules in centrosome-containing cytoplasts; (3) GFP-CLIP-170 expression as a marker for microtubule plus end growth; and (iv) sequential subtraction analysis. ... This result signifies that most MTs persistently grow from their time of birth at the centrosome until their plus end nears the cell margin. ... Growth of nascent MTs in CHO cells was not only persistent but rapid. ...

Еще в разделе: (Показать все результаты (>36) - cellmotility.genebee.msu.ru/ )

• http://cellmotility.genebee.msu.ru/html/articles/jcs.pdf
• http://cellmotility.genebee.msu.ru/html/articles/vorobjev2002CBI.pdf
• http://cellmotility.genebee.msu.ru/html/articles/grigoriev97.pdf

... RUBRRRIKA RUBRIKA Evolution of the Quantitative Measures of Quantum Information: on the Path to a Unified Theory of Quantum Information B. A. Grishanin and V. N. Zadkov Physics Faculty and International Laser Center, Moscow State University, Moscow, 119992 Russia e-mail: grishan@comsim1.phys.msu.su Received July 11, 2002 Abstract--The most general approaches to determining the quantitative measure of quantum information are analyzed based on physical content. ... with an arbitrary state | ...

Еще в разделе: (Показать все результаты (>75) - qilab.phys.msu.ru/ )

• http://qilab.phys.msu.ru/papers/PRA-2000-61-52305-en.pdf
• http://qilab.phys.msu.ru/papers/PRA22309.pdf
• http://qilab.phys.msu.ru/papers/PhysRevA_77_011401.pdf

... Electronic journal Issue 4. 10 september 2004 Briedis V. Pareto Structures A great Italian economist Vilfredo Pareto (1848 ґ 1923) in his unique economics and sociology studies [1, 2] continuously emphasised the systematic approach, reviewing the society development problems. ... Formal model of Pareto Structure First of all, provide a formal mathematical model adequately featuring the Pareto Structure. ... Indeed, I was primarily interested in the classical (harmonic structure) model at s = 1. ...

Еще в разделе: (Показать все результаты (>9) - e-journal.spa.msu.ru/ )

• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./nekipelov.pdf
• Государственное управление. Электронный вестник

... ICONO Invited Speakers . ... Gennadiy Kulipanov, Budker Inst. of Nuclear Physics, Russia . ... Marlan Scully, Texas A&M Univ., ... Andrey Goncharov, Inst. of Laser Physics, Russia . ... Vladimir Trunov, Inst. of Laser Physics, Russia . ... Since 1987, he has worked at the National Research Council of Canada (Ottawa) in the field of laser physics and trapped ion optical frequency standards. ... Alexey Taichenachev , Inst. of Laser Physics, Russia . ... S. Vatnik, Inst. of Laser Physics, Russia . ...

Еще в разделе: (Показать все результаты (>10) - iconolat13.phys.msu.ru/ )

• Guidelines

... Structure, properties, and functions of the human small heat-shock protein HSP22 (HspB8, H11, E2IG1): a critical review. ... The recently described human HSP22 belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain. ... Therefore, an investigation of the structure and properties of HSP22 is desirable for understanding its multiple functions. ... Depending on the cell type and its expression, HSP22 might have either pro- or anti-apoptotic effects. ...

Еще в разделе: (Показать все результаты (>86) - biochem.bio.msu.ru/ )

• Biochemistry Department of Moscow State University | Regulation of muscle
• Structure, properties, and probable physiological role of small heat shock
• Effect of mutations mimicking phosphorylation on the structure and properties

... The SHG enhancement is attributed to the combined effects of the spatial localization of the fundamental field in the MC spacer and the fulfillment of the phase-matching conditions. ... AlGaAs,14 AlAs/AlGaAs,15 and ZnS/SrF2 (Ref. 16) layers, or alternating layers of porous silicon (PS) with different porosities.17,18 Several approaches are used for the calculation of SHG enhancement at the PBG edges of photonic crystals. ... For SHG enhancement at the PBG edge phase matching is even more important. ...

Еще в разделе: (Показать все результаты (>36) - shg.phys.msu.ru/ )

• http://shg.phys.msu.ru/ruscon/articles/pdf/02_JETP_75.pdf
• http://shg.phys.msu.ru/ruscon/articles/pdf/97_PhysRevLett_78.pdf
• http://shg.phys.msu.ru/ruscon/articles/pdf/02_JETP_76_527.pdf

The Future of GPU Computing Wen-mei Hwu University of Illinois, Urbana-Champaign Agenda Ї Ї Ї Ї Setting the Context Current Victories Coming Battles Conclusion and Outlook NVIDIA HPC Day Moscow State University 2012 CPUs: Latency Oriented Design Ї Large caches ґ Convert long latency memory accesses to short latency cache accesses ALU Control ALU ALU Ї Sophisticated control ґ Branch prediction for reduced branch latency ... NVIDIA HPC Day Moscow State University 2012 ...

Еще в разделе: (Показать все результаты (>4) - ccoe.msu.ru/ )

ORF ALEA CENTER FOR GL OB AL INTERNA TIONAL S TUDIES UNIVERSIT Y OF C ALIFORNIA, SANT A BARBAR A THE ROLE OF RELIGION IN GLOBAL CIVIL SOCIETY: THE MOSCOW WORKSHOP Lomonosov Moscow State University Moscow , Russia June 19, 2013 Sponsored by the Henry R. Luce Initiative on Religion and International Affairs Luce Moscow Workshop The Moscow workshop for the Or falea Center 's Luce Project on religion in ... Moscow State University has its own church of the Saint Tatiana. ...

Еще в разделе: (Показать все результаты (>100) - fgp.msu.ru/ )

• http://fgp.msu.ru/wp-content/uploads/2014/09/UNESCO_CHAIR-1.pdf