... Applied Geochemistry , 1999, 14 (2): 95-107. Potential response of forest soils to sulphur deposition in the Norwegian-Russian border area in the surroundings of the Pechenganikel smelters, the major sulphur emitters in the northern Europe, has been assessed with the PROFILE model. The release rate of base cations due to weathering range from 0.05 to 0.28 kmolc/ha/yr in the 0?-?50 cm soil layer, thus demonstrating the high sensitivity of the coarse and thin podzols studied. ...

Еще в разделе: (Показать все результаты (>19) - eco.soil.msu.ru/ )

• Koptsik G.N., et al. Response of pine forests to long-term air pollution at the

... История лаборатории КГЭ . Лаборатория КГЭ сегодня . ... Информация для студентов 1-3 курсов . ... This is Lotus Flower, is a free template from Free CSS Templates released under a Creative Commons Attribution 2.5 License . ... Phasellus tellus turpis, iaculis in, faucibus lobortis, posuere in, lorem. ... Vivamus varius justo sit amet leo. ... Nam cursus, orci sit amet porttitor iaculis, ipsum massa aliquet nulla, non elementum mi elit a mauris. ... Лаборатория катализа и газовой электрохимии | ...

Еще в разделе: (Показать все результаты (>2) - tragaty.chem.msu.ru/ )

. Operation Systems: MS Windows 3.x / 9x / NT . Hardware Requirements: 16 MB RAM (min) 12 Mb hard disk SVGA monitor CD-ROM mouse Latest Maintenance Releases: version 2.1 (16 bit), version 2.5 (32 bit) . 'Химический Верстак' Техническая Спецификация . Предыдущий слайд . Следующий слайд . Первый слайд . Графический вариант .

Еще в разделе: (Показать все результаты (>146) - www.chem.msu.ru/ )

• Program ODF3

SAO is Russia's main centre for ground-based space research. ... The basic instruments of the Observatory are the optical telescope BTA (Big Alt-azimuth Telescope) with a main mirror diameter of 6 m and the radio telescope RATAN-600 with the antenna diameter 600 m. Study of the Universe as a whole, analysis of non-stationary energy release in galactic and extragalactic objects of various types, investigation of evolution and chemical composition of our Galaxy and the nature of solar activity. ...

Еще в разделе: (Показать все результаты (>12) - www.issp.ac.ru/ )

... Carbamide . ... Moscow ? ... URALCHEM and Stamicarbon will develop a new technology for urea production . URALCHEM, a leading Russian producer of nitrogen fertilizers, signed a joint technology development agreement for the synthesis of urea with Stamicarbon, the world's top developer and licensor of urea processes. ... Laboratory of Chemical Thermodynamics  was established by Prof. Adam V. Rakovsky (corresponding member of USSR Academy of Sciences) first as a "halurgy laboratory" in 1930. ...

Еще в разделе: (Показать все результаты (>8) - td.chem.msu.ru/ )

... Применение элокома в комплексной терапии атопического дерматита и псориаза: атопический дерматит, псориаз, элоком, лечение. ... При ряде кожных заболеваний с недостаточно ясным происхождением, но протекающих с явными признаками воспаления и доказанным участием в патогенезе медиаторов воспаления эмпирическое применение антигистаминных средств считается традиционным способом лечения [27]. ... Наш опыт применения кларитина может оказаться интересным для совершенствования их терапии. ... Число больных ....

Еще в разделе: (Показать все результаты (>281) - www.nature.web.ru/ )

• О тактике антибактериальной терапии при абдоминальном сепсисе у хирургических
• Научная Сеть
• Обозначения, единицы измерения и терминология в физике

... Department of Biogeography, Faculty of Geography, Lomonosov Moscow State University, 119991, Russia, Moscow, Leninskie Gory, 1 . ... Scientific Laboratory of Complex Mapping, Faculty of Geography, Lomonosov Moscow State University, 119991, Russia, Moscow, Leninskie Gory, 1 . ... Department of Landscape Geochemistry and Soil Geography, Faculty of Geography, Lomonosov Moscow State University, 119991, Russia, Moscow, Leninskie Gory, 1 . ... Faculty of Geography, Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>223) - www.geogr.msu.ru/ )

• qkbrr
• Instructions for Authors, contributing to ?GEOGRAPHY, ENVIRONMENT,

... Linguistic expeditions . ... Logical and stylistic aspects of lexical semantics . ... Linguistic phenomena can be approached and described from various perspectives. ... The approach proposed here is distinctive in that it is based on logic and stylistics, which are usually considered marginal to the description of linguistic phenomena. ... A special focus in the present approach on parallel texts is directly connected with translation . ...

Еще в разделе: (Показать все результаты (>19) - lcl.srcc.msu.ru/ )

Supernova 2002es in UGC 2708 . This page is devoted to information on Supernova 2002es in UGC 2708 Basic information on this SN, including the last reported brightness, on this Supernova can be found on the main page . Information on the original web pages for many of these images can be found on the updates and links web pages. ... We have a DSS Photometry reference image made by Odd Trondal. ... 2002/08/23.5 . ... 16.5: . ... Light curves and Spectra: . ... Back to Bright Supernovae - 2002 . ...

Еще в разделе: (Показать все результаты (>22) - www.rochesterastronomy.org/ )

• Supernova 2005cs in M51
• Supernova 2007uy and 2008D in NGC 2770

... Выпускники . ... Женский клуб . ... Издательство МГУ . ... Выпускники МГУ . ... Дайв-Клуб МГУ . ... These markers aid physicians in evaluating a patient's risk of developing diseases much as blood lipid levels are used in standard medical practice to monitor the risk of heart disease. ... Using these techniques, it is possible to attain relatively quick answers by monitoring selected signs and damage in the body which prepare the environment for abnormal cell growth and differentiation. ...

Еще в разделе: (Показать все результаты (>257) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Ученые научились определять биологический возраст по...
• Клуб выпускников МГУ: The Blood Test Gets a Makeover
• Клуб выпускников МГУ: Кайя Кальпа: продление жизни и бессмертие

... Scientific laboratories . ... Contact information . ... hitechlab@cs.msu.su . ... 119991, Moscow, GSP-1, Leninskiye Gory, MSU, 2nd Educational Building, CMC Faculty, rooms 753 (Head of the laboratory), 763 . ... The Laboratory of Programming Technologies was established in 2001. ... Presently the main scientific direction of the Laboratory is research and development of algorithms and methods for creating data mining software. ... Intellectual systems of electronic document circulation analysis. ...

Еще в разделе: (Показать все результаты (>74) - en.cs.msu.ru/ )

• Laboratory of Programming Technologies
• Information for foreigners who wish to study at our Faculty | CMC MSU
• Information for foreigners who wish to study at our Faculty

... It is shown that theoretical methods developed for description of hopping transport in disordered inorganic solids, such as amorphous semiconductors, can also be successfully applied to description of hopping transport in organic disordered systems, such as conjugated or molecularly doped polymers. We concentrate our discussion on percolation approach and show its universal applicability to systems with different distributions of localized state energies. ...

Еще в разделе: (Показать все результаты (>67) - scon155.phys.msu.su/ )

• Generalized pair approximation in the description of ate AC conductivity of a
• Kinetics of domain structure in ferroelectric thin films

... The national strategic management system in Russian power industry is far from perfect and is in the process of its formation after a long period of radical reform in the industry. ... This article s goal is to offer a more adaptable conceptual model for national strategic management in a branch of economy (on the example of the electric power industry). ... National strategic management, power industry, conceptual model, level of environmental uncertainty. ... Public Administrarion". ...

Еще в разделе: (Показать все результаты (>518) - ee-journal.spa.msu.ru/ )

ANCIENT RECORDS UNDER ATTACK . ... Robert Russell Newton is an American physicist who has made himself known to historians of astronomy by publishing a number of critical commentaries on early astronomical records. ... Newton's practice is to publish his scientific conclusions in book form, including annotated descriptions of the historical data on which his arguments are based. ... That is the way I shall use Newton's books. ...

Еще в разделе: (Показать все результаты (>86) - hbar.phys.msu.ru/ )

• The jump of the second derivative of the moon's elongation

This document contains frames

Еще в разделе: (Показать все результаты (>27) - shg.phys.msu.ru/ )

... Aim: to outline the key issues for NGOs considering engaging with the private sector as a development strategy. ... Substantial cases documented in detail a number of specific examples of NGO-business relationships for analysis and comparison relating to key research questions: What form relationships take, how and why these are changing over time; what has worked; what organisational and management issues arise; and whether there are lessons to be drawn across business/NGO sectors. ...

Еще в разделе: (Показать все результаты (>74) - www.prof.msu.ru/ )

• ENDING TRAFFICING IN WOMEN
• Global Terrorism, Domestic Order and the United States
• Small grants projects that will be most likely to receive funding?

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

О лаборатории . ... Лаборатория теоретической биофизики . ... The script generates nanotubes of arbitrary structure. ... To use it, save script to some file, then load into PyMol with the command: run /path/to/script.py . ... Here comes the script : # Nanotubes generating script for PyMol by piton at erg .biophys.msu.ru import cmd from math import cos,sin,pi,ceil,floor, acos from chempy import models, cpv class cell: def __init__(self ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>30) - erg.biophys.msu.ru/ )

• Quantum chemistry information page ERG Research Group: Лаборатория

... О физическом факультете . ... Физический факультет . ... 22.11.2004 Приглашаем студентов старших курсов, аспирантов и выпускников физико-математических и технических вузов на презентацию компании CHG-MERIDIAN Leasing, специализирующаяся на лизинге IT оборудования . Компания CHG-MERIDIAN Leasing была основана в 1979 году в Германии. ... Кроме Германии, офисы CHG-MERIDIAN Leasing есть в Великобритании, Ирландии, Франции, Италии, Нидерландах, Бельгии, Австрии, Швейцарии и Восточной Европе. ...

Еще в разделе: (Показать все результаты (>116) - phys.msu.ru/ )

. Name . Last modified . Size . Description . about_center/ . 14-Sep-2013 14:31 . - . sections/ . 31-Oct-2007 14:46 . - . Apache/2.2.16 (Debian) Server at educenter.sinp.msu.ru Port 80

Еще в разделе: (Показать все результаты (>9) - educenter.sinp.msu.ru/ )