... MCCME, Moscow 3 papers and (a) English edition of the textbook "Probability", vol. ... Springer, Berlin, 2006. ... 4 C. Conferences (as a participant): · Plenary talk at the Conference on Probability Theory and Mathematical Statistics dedicated to the centenary of A. N. Kolmogorov (September 21­27, 2003, Tbilisi, Georgia); · Plenary talk at the Franco- Russian Colloquium Perspectives de coopґ ation en informatiques et mathґ er ematiques appliquґ ees (October 2003, Moscow ); · Plenary ...

Еще в разделе: (Показать все результаты (>45) - new.math.msu.su/ )

• http://new.math.msu.su/department/probab/spec/Materialy_po_kursam_Tutubalina/Finstat/Bashelie/Bachelier100years.pdf
• http://new.math.msu.su/Sites/demosite/Uploads/roaz.978E555EE90844F3B38BFC97BCDC69F3.pdf
• http://new.math.msu.su/department/probab/bsk15_2.htm

... include stdio.h # include stdlib.h int main( int argc, const char* argv[]) { FILE* f; int c, wordCnt = 0, inWord = 0; if (argc 2) { printf ( Use: %s filename\n , argv[0]); return 1; } f = fopen(argv[1], r ); if (f == NULL) { printf ( Can't open file: %s\n , argv [1]); return 1; } while ((c = fgetc(f)) if (!isspace(c)) if (! inWord ) { ++wordCnt; inWord = 1; } } ... int main() { enum {RUNNING, STOPPED} state; state = RUNNING; state = STOPPED; } RUNNING STOPPED · : 1. ...

Еще в разделе: (Показать все результаты (>3) - savenkov.lvk.cs.msu.su/ )

... Paradigm shifts by Kuhn: successive change of one model by another, rather than integration of different paradigms Progress of science: from single- to multi-model approach Some examples from natural science... · theory of light: from vibration of ether to wave-particle duality · laws of motion: from Newton's dynamics to SchrЖdinger 's and Heisenberg's formalism In social and environmental sciences appreciation of the multi-model ...

Еще в разделе: (Показать все результаты (>9) - oc.cs.msu.ru/ )

... Symposium expenses . ... Abstract submission . ... 14 European Symposium on . Gas Phase Electron Diffraction . ... The deadline for abstract submission is 20 April, 2011. The abstracts have to be sent to the Symposium web address:  ed.mos2010@gmail.com .  ... Arial font and single spacing should be used throughout. The title should be centered and set with 14-point bold font style. ... The main body of text should be fully justified and set in 12-point regular font style. ...

Еще в разделе: (Показать все результаты (>15) - ged.chem.msu.ru/ )

• Program. 14 European Symposium on Gas Phase Electron Diffraction
• Cultural Program. 14 European Symposium on Gas Phase Electron Diffraction

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

... Only by numerical simulation. ... moment T (K) Dipole moment (D) Experiment Other example: Diffusion constant 200 250 298 350 400 2.40 2.37 2.48 2.59 2.80 2.25 The Distribution functions: radial distribution function 1 g (r) = N t =1 j i N TS N pair ( r - rij ) The Distribution functions: radial distribution function CC def 2 Work mode ­ computer related 1) · Perform simulation , create trajectory file · Calculate properties timestep by timestep 2) · Perform ...

Еще в разделе: (Показать все результаты (>30) - www.elch.chem.msu.ru/ )

• Molecular aspects of solid state and interfacial electrochemistry

... Subject to the MOIP Charter both natural and legal persons may become the members of the Society upon paying admission fees and acknowledging the Charter and program documents. ... Persons may be elected as the Society?s full and corresponding members on a show of hands at the Society?s Council (Presidium) meeting if nominated by a section and recommended by at least two full Society?s members. ... The Society?s full members have the following rights: . ... 2015 Moscow Society of Naturalists . ...

Еще в разделе: (Показать все результаты (>7) - www.moip.msu.ru/ )

... Here is a brief outline of the current theory of the events in the early history of the solar system: . A cloud of interstellar gas and/or dust (the "solar nebula") is disturbed and collapses under its own gravity. ... The gas cools off enough for the metal, rock and (far enough from the forming star) ice to condense out into tiny particles. (i.e. some of the gas turns back into dust). ... Once the larger of these particles get big enough to have a nontrivial gravity, their growth accelerates. ...

Еще в разделе: (Показать все результаты (>2) - www.iki.rssi.ru/ )

The M.V. Lomonosov Moscow State University is organizing a traditional International Conference "BIOCATALYSIS-2007" in 17-22 June 2007 (preliminary dates were changed). ... Structure, catalytic mechanism and protein engineering of enzymes. ... EURO . ... In view of a limited number of ship cabin passengers, the Organizing Committee is asking to apply for participation at BIOCATALYSIS-2007 Conference, to send the Abstracts and to pay the Registration Fee not later than the deadlines indicated above. ...

Еще в разделе: (Показать все результаты (>128) - www.enzyme.chem.msu.ru/ )

... Head of the laboratory of Magnetic Semiconductors. ... magnetic semiconductors, spin glasses, chalcogenide spinels, manganites, magnetic two-phase state. ... In antiferromagnetic (AF) semiconductors the ferrons can exist leading off T = 0 and in F semiconductors the ones can present in vicinity of Curie point. ... L.I. Koroleva "Antiferron states of charge carriers in the ferromagnetic semiconductors CuCr2S4-xSex (0.5?x?1.5) with Curie points above room temperature", JETP, 79, No 1, p. 153-162, 1994...

Еще в разделе: (Показать все результаты (>18) - ferro.phys.msu.ru/ )

Lomonosov Moscow State University was established in 1755 . ... Lomonosov Moscow State University Diary . ... MSU Web Sites . ... General Information . ... Most programs at the Moscow State University are taught in Russian. ... passing Russian State Exam (ЕГЭ), following the general rules on http://cpk.msu.ru ), . ... Lomonosov Moscow State University Institute of Russian Language and Culture . ... Lomonosov Moscow State University . ... Copyright 1997?2016 Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>119) - www.msu.ru/ )

• Further Education Programs at MSU
• School of Television
• FACULTY OF PSYCHOLOGY

... Чтобы сделать nature.web.ru своей стартовой страницей: . ... В меню View (Вид) выберите Internet Options (Свойства обозревателя). В разделе Home page (Домашняя страница) введите http://nature.web.ru в поле Address (Адрес). Нажмите кнопку OK. для Internet Explorer 3.0 . ... В поле Page выберите Start Page. ... Нажмите кнопку OK. Затем нажмите кнопку Home на панели инструментов. для Netscape Communicator . ... В поле формы ниже Home Page Location введите http://nature.web.ru . ...

Еще в разделе: (Показать все результаты (>255) - www.nature.web.ru/ )

• Научная сеть: Руководство для авторов

... At present, SDSS (ugriz), UKIRT WFCAM (YJHK), ; Johnson-Cousins (UBVRcIc), and 2MASS (J2H2Ks2) ; are supported ; redshift - redfshift of a galaxy ( floating point) ; colour_name - colour identification (string) ; colour_value - value of colour in magnitudes ( floating point) ; should be in the AB mags for ugrizYJHK ; and in Vega mags for Johnson-Cousins/2MASS colours ; ; RETURN VALUE: K-correction in the specified filter for given redshift ; and ...

Еще в разделе: (Показать все результаты (>6) - kcor.sai.msu.ru/ )

• http://kcor.sai.msu.ru/calc_kcor.pro

Neutrino telescope in Northern Hemisphere . ... about ANTARES . ... Division of General Nuclear Physics MSU . ... The First Joint Seminar MSU-ITEP about activity in ANTARES was held 8-9th of September 2010 in MSU Nuclear Physics Institute. ... 10:40 Status of ANTARES at MSU E. Shirokov . ... 11:15 Status of ANTARES M. Anghinolfi pdf . ... Prof. M. Anghinolfi (INFN, Genova) . ... Prof. M. Anghinolfi, prof. A. Rostovtsev (ITEP) and prof. A. Capone during coffee brake . ... MSU, Faculty of Physics, 2009. ...

Еще в разделе: (Показать все результаты (>18) - antares.sinp.msu.ru/ )

The file a_news.php had been edited by : IP: 193.232.121.99 Time: 22.12.2008|12:28:34 This message had been generated by http://www.web2ftp.com On abuse issues, please contact abuse@web2ftp.com

156. Faculty Staff

157. The Deep Purple Discographies

158. http://lvk.cs.msu.su/~bahmurov/course_realtime/papers/balashov_et_al_eucass2011_monitoring.doc

159. MSM 2007

160. http://asa.guru.ru/papers/pap3.ps