SEMINAR Singular Perturbations and Time Scales (SPaTS) in Control Theory and Applications 14:30 PM, Saturday, June 23, 2012, Room 5-18 Faculty of Physics, M.V. Lomonosov Moscow State University , Moscow, Russia Professor D. Subbaram Naidu , PhD, PE, Fellow IEEE Director and Professor, School of Engineering Director, Measurement and Control Engineering Research Center Idaho State ...
[
Текст
]
Ссылки http://matematika.phys.msu.ru/files/seminar/189/Naidu_SPaTS_Presentation_MoscowStateUniversity_2012_06_23_Abstract+and+Biography.pdf -- 98.8 Кб -- 14.06.2012 Похожие документы
... Earlier still lies the remaining frontier, where the first stars, galaxies and massive black holes formed. ... Building on this general framework, and relying on the development of efficient new computational tools, the fragmentation properties of primordial gas inside such minihaloes were investigated with numerical simulations, leading to the result that the first stars, so-called population III, were predominantly very massive4,8 (see Box 1 for the terminology used here). ... Astrophys. ... III. ...
[
Текст
]
Ссылки http://ocean.phys.msu.ru/courses/geo/lectures-addons/02/2009%20Bromm%20et%20al.%2C%20The%20formation%20of%20the%20first%20stars%20and%20galaxies.pdf -- 799.2 Кб -- 28.08.2009 Похожие документы
1990k: 70007 70E99 (58F40, 76D25) Samsonov V.A., Shamolin M.V. On the problem of the motion of a body in a resisting medium (Russian). ... 70: Mechanics of particles and systems. 70E: Dynamics of rigid body. ... 58F: Ordinary differential equations on manifolds; dynamical systems. ... Russian. ... 34: Ordinary differential equations. ... As applications we consider dynamical systems that describe the plane-parallel motion of a body in a resisting medium as well as various model variants of it." ...
... Here is a brief outline of the current theory of the events in the early history of the solar system: . A cloud of interstellar gas and/or dust (the "solar nebula") is disturbed and collapses under its own gravity. ... The gas cools off enough for the metal, rock and (far enough from the forming star) ice to condense out into tiny particles. (i.e. some of the gas turns back into dust). ... Once the larger of these particles get big enough to have a nontrivial gravity, their growth accelerates. ...
... БИБЛИОТЕКА НИИЯФ МГУ . ... Полный список журналов ELSEVIER и SpringerLink доступных в 2011 году . ... Электронные ресурсы НИИЯФ МГУ . ... Acta Physica Hungarica, New Series, Heavy Ion Physics . ... Applied Physics Letters . ... аннотации . ... Astrophysical Journal, Astrophysical Journal Letters, Astrophysical Journal Supplement series . ... Journal of Physical Chemistry A . ... The European Physical Journal - Applied Physics . ... The European Physical Journal E: Soft Matter and Biological Physics ...
... Stanley Milgram SIX DEGREES OF SEPARATION OR SMALL WORLD PHENOMENON 1998, Small world networks Steven Strogatz Duncan Watts Laszlo Barabasi and Reka Albert 1999 In 1999 American physicits Barabasi and Albert have shown that distribution of nodes by the number of links in tke most real networks is described by power law and they called such networks as scale-free networks Reprinted from Linked: The New Science of Networks by Albert-Laszlo ... Human disease network. ... disease , ). ...
[
Текст
]
Ссылки http://www.soc-phys.chem.msu.ru/rus/prev/zas-2015-12-01/presentation.pdf -- 1351.3 Кб -- 25.12.2015 Похожие документы
Summary Progress Report 2010 2014 UNESCO Chair on Global Problems and Emerging Social and Ethical Challenges for Large Cities and Their Population at the Faculty of Global Processes of the Lomonosov Moscow State University Period of activity: September 2010 June 2014 Title of the Chair : UNESCO Chair on Global Problems and Emerging Social and Ethical ... Visit of UNESCO Director-General Irina Bokova at Moscow State University September 9, 2011. ...
[
Текст
]
Ссылки http://fgp.msu.ru/wp-content/uploads/2014/09/UNESCO_CHAIR-1.pdf -- 1926.1 Кб -- 13.09.2014 Похожие документы
VARIABLE STARS, THE GALACTIC HALO AND GALAXY FORMATION C. Sterken, N. Samus and L. Szabados (Eds.) 2010 Formation Mechanisms for Spheroidal Stellar Systems O. K. Sil'chenko 1 Sternberg Astronomical Institute of the Moscow State University, Moscow, Russia Abstract. Spheroidal stellar systems on various scales include elliptical galaxies, dwarf spheroidal galaxies, and globular stellar clusters. ... The formation mechanisms of the oldest globular clusters represent a puzzle yet. ... 2009). ...
AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...
Mikhail A. Vorotyntsev . Principal Publications . ... Electrochemistry of Electroactive Materials, A. R. Hillman, P. J. Kulesza, M. A. Vorotyntsev, Electrochim. ... Electrochemistry of Electroactive Polymer Films, P. J. Kulesza, M. A. Vorotyntsev, Electrochimica Acta, 2001, vol. ... Potential Distribution across the Electroactive-Polymer Film between the Metal and Solution as a Function of the Film Charging Level, M. A. Vorotyntsev, A. A. Rubashkin, J. P. Badiali, Electrochimica Acta, 1996, vol. ...
Academic English Part 4 of 4 Sources: 1. ... Cambridge University Press Unit After · · 51 completing the tasks the students will: Learn about US system for higher education in science Learn some communicative strategies they might use when asking for help or information from colleagues · Learn to write a CV and participate in an interview · Revise their reading strategies · Revise their summarizing strategies Camb 1. 2. 3. 4. ridge English for Scientists, Unit 1, pp.6-7 all ...
Spinar Paradigm and Central Engine of the All Types Gamma Ray Bursts V.Lipunov1,2,3 & E.Gorbovskoy1,2,3 1Sternberg Astronomical Institute, Moscow, Universitetsky pr. ... A spinar is a quasi-equilibrium collapsing object whose equilibrium is maintained by the balance of centrifugal and gravitational forces and whose evolution is determined by its magnetic field. ... 10 Computed energy release during the process of collapse with low angular momentum and weak magnetic field. [pic] Fig .11. ...
[
Текст
]
Ссылки http://observ.pereplet.ru/images/evgeny/magneto21jun07Eng.doc -- 683.5 Кб -- 21.06.2007 Похожие документы
XXIV , . ... Handbook of Acoustics, Edited by Malcolm J. Crocker, John Wiley & Sons, INC, 1998,1461 p. 2. Witham G.B. Linear and Nonlinear Waves. ... Lili Ganjehi, Regis Marchiano, Francois Coulouvrat, Jean-Louis Thomas, Evidence of wave front folding of sonic booms by a laboratory -scale deterministic experiment of shock waves in a heterogeneous medium , J. Acoust. Soc. ... V. 124(1), 2008, pp. ... 161 XXIV , . ... 8) - S ( z ) + V = S ( z ) V V V V 2 z , Vmin , Vmax . ... V + Vmax . ...
[
Текст
]
Ссылки http://acoustics.phys.msu.su/teachers/gusev_files/rao24-1.pdf -- 485.5 Кб -- 07.11.2012
[
Текст
]
Ссылки http://acoustics.phys.msu.ru/teachers/gusev_files/rao24-1.pdf -- 485.5 Кб -- 07.11.2012 Похожие документы
Space Weather . ... Space weather . ... Data . ... You should fill in "Workspace" by groups of data sets to create plots. ... Putting different kind of data into the same plot remember, that the first dropped data set chooses and determines the axis scale for all data. ... If you need both kind of scale in the same plot, create two different plots and unite them. The speed of this service depends on 3 components: data processing on server, data transmission and data plotting in your browser. ...
Модификации метода Монте-Карло с критерием Метрополиса. Одна из модификаций метода Монте-Карло - метод SCV MC (Scaled Collective Variables Monte Carlo) - позволяет значительно сократить время расчета траектории, но только вблизи минимума, отвечающего, например, нативному состоянию. Все валентные связи и валентные углы в этом методе жестко фиксированы. ... Собственные значения этой матрицы являются силовыми константами независимых гармонических колебаний в системе. ...
... CpAppro . ... TernAPI program . ... Home Our Developments CpAppro . ... The above equation is a linear combination of thermodynamic functions of the harmonic oscillator (Planck-Einstein functions). This approach is developed as a part of a universal method of approximating temperature dependences of standard thermodynamic properties for crystalline substances. ... Colloquium on 24.12.12 20 Dec 2012 . ... Laboratory of Chemical Thermodynamics . ... 2000-2016 Laboratory of Chemical Thermodynamics . ...
... Nonlinear optics of ionized mediums . Fiber lasers . ... Emergence of powerful laser systems, being able to deliver powerful ultrashort light pulses, allows one to investigate and exploit new class of nonlinear-optical phenomena, based on the media ionization, when the electrons are released by strong electromagnetic field directly or by collision of an atom with another electron accelerated in the field. ... Ultrafast optical switching of an ionized medium by interfering ultrashort laser pulses. ...
... Oxygen-induced Regulation of Na/K ATPase in cerebellar granule cells. ... Adjustment of the Na/K ATPase activity to changes in oxygen availability is a matter of survival for neuronal cells. We have used freshly isolated rat cerebellar granule cells to study oxygen sensitivity of the Na/K ATPase function. Along with transport and hydrolytic activity of the enzyme we have monitored alterations in free radical production, cellular reduced glutathione, and ATP levels. ...