... Education: Ph.D. in physics, Moscow State University, 1996, . ... 1998 - present time Research fellow at Moscow State University . ... 1996 - 1998 Junior research fellow at Moscow State University . ... February 1995 - April 1995 Visitor at Dept. of Solid State physics of Catholic University of Nijmegen, The Netherlands . ... 2002 Stipendia for young educators and young scientists of Moscow State University . ... Dept. of Physics, Moscow State University, 119992 Vorob'evy Gory, Moscow, Russia . ...

Еще в разделе: (Показать все результаты (>39) - shg.phys.msu.ru/ )

... N.5, pp.592-597 (scanned PDF file, English version) . ... A.V.Shanin, Embedding formula for electromagnetic diffraction problem // Zapiski seminarov POMI, V.324, pp.247-261 (2001), in Russian, (PDF file, Russian version) (PDF file, English version) . ... PDF file) . ... Shanin A.V., Coordinate equations for the Laplace-Beltrami problem on a sphere with a cut // QJMAM, 2005 (58) 2, 1-20 The preprint versions of two previous papers have been sent to URSI contest: Paper 1, PDF file , Paper 2, PDF file ...

Еще в разделе: (Показать все результаты (>41) - acoustics.phys.msu.ru/ )

Semikoz V. B., Sokoloff D., Valle J.W.F. Lepton asymmetries and primordial hypermagnetic helicity evolution, eprint arXiv:1205.3607, 12 p., 2012 . The hypermagnetic helicity density at the electroweak phase transition (EWPT) exceeds many orders of magnitude the galactic magnetic helicity density. ... This should be taken into account in scenarios of galactic magnetic field evolution with a cosmological seed. ...

Еще в разделе: (Показать все результаты (>102) - srcc.msu.ru/ )

• V.B.Semikoz, D.D.Sokoloff, J.W.F. Valle, Lepton asymmetries and primordial
• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• Kazakevich, Olga. Endangered Languages Documentation and Description: Should

Title Author Key words New approaches to Marxist theory: Analytical Marxism Dobrinskaya D.E. Analytical Marxism, Marxism, Class, Exploitation, Historical Materialism This article presents a general description of school, which occurs in the 80s of XX century classic categories of Marxist theory in modern sci main research topics of key representatives considered. Analytical Marxism scientific as an attempt to reconstruct ence. Methodological features, of this Marxist school are Abstract

Еще в разделе: (Показать все результаты (>64) - www.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/eng/archive/2015/3/01.pdf
• http://www.socio.msu.ru/vestnik/archive/2011/2/02.pdf
• Вестник МГУ

... Abstract A Uniform Resource Identifier (URI) is a compact string of characters for identifying an abstract or physical resource. ... This document defines a grammar that is a superset of all valid URI, such that an implementation can parse the common components of a URI reference without knowing the scheme-specific requirements of every possible identifier type. ... URI-reference = [ absoluteURI | ... Otherwise, the reference URI's scheme is inherited from the base URI's scheme component. ...

Еще в разделе: (Показать все результаты (>4) - hea-www.harvard.edu/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1945.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1808.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc2068.txt

Geometric Structures in Integrable Systems Sergey Adzhiev (with Victor Vedenyapin), Entropy for generalised quantum kinetic and Liouville equations. Abstract: In his 1872 paper L. Boltzmann proved H-theorem for a class of kinetic equations. ... Abstract: P. Clarkson and M. Kruskal (1989) proposed a method for finding reductions of partial differential equations with two independent variables. ... Gennady El, Kinetic equation for a soliton gas ­ a new integrable system? ...

Еще в разделе: (Показать все результаты (>71) - new.math.msu.su/ )

• http://new.math.msu.su/department/probab/bsk_22_01.pdf
• http://new.math.msu.su/department/probab/spec/Materialy_po_kursam_Tutubalina/Finstat/Bashelie/Bachelier100years.pdf

... Cultural Mediation of National History and Identity . ... Second International Conference in Tampere , Finland . ... This sense of national identity, of history and possible futures, is communicated by cultural and institutional forces and integrated, individually and collectively, into our sense of a common shared nationhood. ... Through a semiological analysis of television texts, it is demonstrated how, by a re-interpretation of Russian history, new cultural and national identities are...

Еще в разделе: (Показать все результаты (>10) - psyberlink.flogiston.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

... 2 · ­ , , · ­ · ­ , 03.12.2015 . ... 14 03.12.2015 · · · 03.12.2015 . ... Verifier Uni ve rsi ty of Te x as 2013 Anteater Uni ve rsi ty of Il l i noi s 2011 FlowChecker Uni ve rsi ty of North Carol i na 2010 VERMONT Network disjoint Port #02 Port #03 h2 h3 s1 Port #01 h1 Port #04 h4 main: disjoint() := Forall[x, out_x, y, out_y: !R(x, out_x) or !R(y, out_y) or x[p] == out_y[p] and out_x[p] == y[p] or x VERMONT proxy CLI Packets are delivered through the control plane We can block them! ...

Еще в разделе: (Показать все результаты (>7) - lvk.cs.msu.su/ )

Welcome to Fourmilab 's calendar converter! ... In the Julian calendar every fourth year is a leap year in which February has 29, not 28 days, but in the Gregorian, years divisible by 100 are not leap years unless they are also divisible by 400. ... The average length of a year is 365.2468 days compared to the actual solar tropical year (time from equinox to equinox) of 365.24219 days, so the calendar accumulates one day of error with respect to the solar year every 216 years. ... Excel serial day: . ...

Еще в разделе: (Показать все результаты (>15) - sbmg.geol.msu.ru/ )

• Список элементов HTML

html head title Перемещение слоя в режиме drag /title script language= javaScript !-- var app; var szx = 0 ; var szy = 0 ; function start_drag () { app = document.applets.red; app.open_change_mode(0); rc = app.set_current_layer(' show '); if( rc==-1 ) {alert( Нет указанного слоя show ); return ;} app.set_ drag _layer( show ); drag (); ...

Еще в разделе: (Показать все результаты (>21) - adept.srcc.msu.ru/ )

• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/drag/drag2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch1text1.htm

. Name . Last modified . Size . Description . about_center/ . 14-Sep-2013 14:31 . - . sections/ . 31-Oct-2007 14:46 . - . Apache/2.2.16 (Debian) Server at educenter.sinp.msu.ru Port 80

Еще в разделе: (Показать все результаты (>9) - educenter.sinp.msu.ru/ )

... High Brightness RTM . ... Fig.1a: 70-MeV pulsed race-track microtron . Many applications require compact, inexpensive and efficient source of electron beam in energy range 10-100 MeV. ... Beam is focused by accelerating structure, which acts as RF quadrupole singlet, quadrupole triplets (12) installed at the even orbits return path and by electromagnet quadrupole singlet (9) installed at common axis. ... Fig.1b: 70-MeV RTM Schematic . ... Energy gain: 4.8 MeV / orbit . Orbits: 14 . ...

Еще в разделе: (Показать все результаты (>2) - vserv.sinp.msu.ru/ )

... Географии мирового хозяйства . ... Ученый совет . ... География" . ... Образование . ... Научно-методический совет по экологии Министерства образования и науки РФ . ... Гранты . ... База данных "Пластовые льды" The massive ground ice database . ... Massive ground ice database is under compilation in HTML format, which gives the opportunity to browse it using any JAVA -browsers. ... Encarta Interactive World Atlas 2001 was used as an index map for positioning the sites covered by data (publication). ...

Еще в разделе: (Показать все результаты (>234) - www.geogr.msu.ru/ )

• nlrsl
• wnsvnttw iybtwjfpGS (все сообщения)
• CONTENTS ? 3 - 2012

... CELL BIOPHYSICS Application of a Photosystem II Model for Analysis of Fluorescence Induction Curves in the 100 ns to 10 s Time Domain after Excitation with a Saturating Light Pulse N. E. Belyaevaa, V. Z. Pashchenkoa, G. Rengerb, G. Yu. ... In the case of weak measuring light, the steady-state level of fluorescence induction curve (Fig. ... The model of PSII predicted that, upon long (10 s) exposure to weak measuring light, the states with open RCs are being populated (Fig. 4, curves 3, 5 QA). ......

Еще в разделе: (Показать все результаты (>35) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/PDF/3336.pdf
• http://library.biophys.msu.ru/PDF/3343.pdf
• http://library.biophys.msu.ru/PDF/3347.pdf

... Boris A. Grishanin, Victor N. Zadkov International Laser Center and Physics Department, Moscow State University, Moscow 119899, Russia ABSTRACT Quasiclassical methods for simulation of electronically excited polyatomic molecule's dynamics in pulsed laser field, which are the combinations of classical molecular dynamics method and quantum calculations of the electronic excitation, are discussed. ... Then, process of an initial electronic excitation of a molecule by pulsed resonant laser field. ...

Еще в разделе: (Показать все результаты (>77) - qilab.phys.msu.ru/ )

• http://qilab.phys.msu.ru/papers/SPIE-4750-54-63(2002).pdf
• Quantum Information Lab, Int'l Laser Ctr. and Faculty of Physics, M.V.Lomonosov

... Advanced chapters of operation research . Algebraic characterization of basic solution of linear program. ... Advanced chapters of Actuarial Mathematics . ... Discounted cash flow analysis and capital budgeting as decision tools are given particular emphasis. ... In the first part of the course we present a modern approach to modeling economic systems. ... The problem of tax optimization under a given financing budget. ... Магистратура: master@cmc.msu.ru, 3-й этаж, комната 360, тел. ...

Еще в разделе: (Показать все результаты (>10) - hcs.cmc.msu.ru/ )

• Master program "Enterprise Information Systems" | Магистерское и послевузовское
• Mathematical models and methods in VLSI design | Магистерское и послевузовское

... International Relations in Context of Global Processes - 17| ... GLOBAL ECONOMIC AND POLITICAL TRENDS Prof. Olga Y. Kornienko Economic literature survey Week 1 (4 academic hours ) 1) Current trends of global economy Week 2 (4 academic hours ) 2) Migration, population and globalization Week 3 (4 academic hours ) 3) Corporate culture and management: new trends Week 4 (4 academic hours ) 4) Development markets in global environment Week 5 (4 academic ... Models of the global world. ...

Еще в разделе: (Показать все результаты (>90) - fgp.msu.ru/ )

• http://fgp.msu.ru/wp-content/uploads/2013/12/Luce_Moscow_2013_small.pdf
• Orfalea Center represented at ?Globalistics 2013? Congress in Moscow, Russia

... 1 : -1); } function global_depth($f) { $flds = _read('folders.dat'); if ($f == '') return 0; $j = $f; $d = 0; while ($flds[$j]['parent'] != '') { $j = $flds[$j]['parent']; $d++; } return $d + 1; } function fext($url) { return strtolower(substr($url, strrpos($url, '.')+1)); } function global_drawfile($id) // { global $lang; $dscs = _read('files.dat'); // global $lang; if (isset($dscs[$id])) { $s = ' . ... lang=='en'?date('Y/m/d h:i A', $dscs[$id]['time']):date('d.m.Y H:i', $dscs[$id]['time'])).' ...

160. Statistics One, Lecture 3, example script