... N.5, pp.592-597 (scanned PDF file, English version) . ... A.V.Shanin, Embedding formula for electromagnetic diffraction problem // Zapiski seminarov POMI, V.324, pp.247-261 (2001), in Russian, (PDF file, Russian version) (PDF file, English version) . ... PDF file) . ... Shanin A.V., Coordinate equations for the Laplace-Beltrami problem on a sphere with a cut // QJMAM, 2005 (58) 2, 1-20 The preprint versions of two previous papers have been sent to URSI contest: Paper 1, PDF file , Paper 2, PDF file ...

Еще в разделе: (Показать все результаты (>38) - acoustics.phys.msu.ru/ )

... Post Office Box 786 . ... Post Office Box 197 . ... Post Office Box 161 . ... Originally published in Russian as Sistemologiya i yazikoviye aspekti kibernetiki . ... Melnikov. G. P. [Sistemologiya i yazikovye aspekty kibernetiki. ... Systemology and linguistic aspects of cybernetics/G. P. Melnikov: . ... Studies in cybernetics; v. 16) . Translation of: Sistemologiya i vazkovye aspektv kihernetiki. ... Cybernetics. ...

Еще в разделе: (Показать все результаты (>40) - old.philol.msu.ru/ )

• Human Language - Язык Человека
• HumLang - Translation System

e-mail: dugin@rossia3.ru) , , , , , , , global society, civil society, sociology' ethnosociology, human rights, globalization, identity " ", . The article examines the concept of social identity from the ethnies of civil society is stressed. The globalization. ... The global nature author gives brief survey of main theories of the y of human rights" and its philosophical premisses are ...

Еще в разделе: (Показать все результаты (>17) - vestnik.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/archive/2012/3/02.pdf
• http://www.socio.msu.ru/vestnik/archive/2013/1/08.pdf

opportunities right in Goldman Sachs European Special Situations Group (ESSG), Moscow Sometimes the greatest are front of you. Internship, 6 months, Immediate Start Goldman Sachs is a global investment banking, securities and investment management firm. ... ESSG is the European arm of Goldman Sachs Global Special Situations Group with over $20bn assets under management. ... Closing date: 26 October 2007 Goldman Sachs is an equal opportunity employer. ...

Еще в разделе: (Показать все результаты (>44) - www.msu.ru/ )

• http://www.msu.ru/science/details/2010/101021-moscow-how.pdf

... Ярмарка вакансий и стажировок для студентов и выпускников вузов . ... Вакансии . ... Информация о компании: Procter . ... BECOME A SUPPLY CHAIN LEADER! The mission of the Supply Network Operations team in P&G is to transform consumer demand into a supply plan and deliver the products to the shelves so that right P&G products are at the right place at the right time - and at the right cost and are available to P&G Consumers. ... Qualifications to succeed in Supply Network Operations: . ...

Еще в разделе: (Показать все результаты (>29) - www.physcareer.ru/ )

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>274) - monkey.belozersky.msu.ru/ )

• SDPpred
• Inquiry information || Parsimony algorithm
• Inquiry information || Distances

... On Invariant Manifolds of Nonholonomic Systems Valery V. Kozlov * V.A. Steklov Mathematical Institute Russian Academy of Sciences ul. Gubkina 8, Moscow, 119991 Russia Received December 27, 2011; accepted January 23, 2012 Abstract--Invariant manifolds of equations governing the dynamics of conservative nonholonomic systems are investigated. ... 2 2012 ON INVARIANT MANIFOLDS OF NONHOLONOMIC SYSTEMS 135 We emphasize that the system of differential equations (2.3) is closed and has the form (1.6). ...

Еще в разделе: (Показать все результаты (>105) - ics.org.ru/ )

• Institute of Computer Sciences - Publications

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>155) - www.pereplet.ru/ )

... L Сd , Pol a nd ABOUT EFFECTIVE MODES METHOD FOR DESCRIPTION OF INTERNAL DYNAMICS OF WEAKLY BOUND CLUSTERS Elena Belega, Evgeny Cheremukhin 1 , Dmitry Trubnikov Abstract: New approach to describe the internal dynamics of weakly bound clusters is presented. ... It is found that the number of active collective modes depends on the initial cluster excitation and that the internal energy is partitioned nonuniformly among the modes. ... Collective motion of oxygen atoms performs mostly in plane. ...

Еще в разделе: (Показать все результаты (>19) - beams.chem.msu.ru/ )

• http://beams.chem.msu.ru/sotrudniki/larin/IJQCh_04.pdf

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>14) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/docs/INFN%20-%20Paper%202.pdf
• http://antares.sinp.msu.ru/docs/INFN%20-%20ANTARES.pdf
• http://antares.sinp.msu.ru/docs/INFN%20-%20NEMO.pdf

A good description of how to make transformations between the different coordinate systems can be found in a paper by M. A. Hapgood, "Space physics coordinate transformations: A user guide", in Planetary and Space Science, Vol. ... X = First point of Aries (Vernal Equinox, i.e. from Earth to the Sun in the first day of Spring) . Z = Earth's mean spin axis . ... T = (Omega x R) / | ... X = Earth-Sun Line . Z = Ecliptic North Pole . ... Z = North Pole of solar rotation axis . ...

Еще в разделе: (Показать все результаты (>201) - www.kosmofizika.ru/ )

• Index of /sinp/panasyuk/cr18_files
• Index of /sinp/panasyuk/cr10_files
• Index of /sinp/panasyuk/cr13_files

ORF ALEA CENTER FOR GL OB AL INTERNA TIONAL S TUDIES UNIVERSIT Y OF C ALIFORNIA, SANT A BARBAR A THE ROLE OF RELIGION IN GLOBAL CIVIL SOCIETY: THE MOSCOW WORKSHOP Lomonosov Moscow State University Moscow , Russia June 19, 2013 Sponsored by the Henry R. Luce Initiative on Religion and International Affairs Luce Moscow Workshop The Moscow workshop for the Or falea Center 's Luce Project on religion in ... Moscow State University has its own church of the Saint Tatiana. ...

Еще в разделе: (Показать все результаты (>72) - fgp.msu.ru/ )

Cooperation with Third Country participants Cooperation with Third Country Participants in an EC funded FP7 multi-partner research project1 - Practical Advice for Proposal Submission and Negotiation ­ What are Third Country Participants in this context? ... For a complete list of associated countries see ftp://ftp.cordis.europa.eu/pub/fp7/docs/third_country_agreements_en.pdf. ... 2 Cooperation with Third Country participants account by the coordinator already at the proposal stage. ...

Еще в разделе: (Показать все результаты (>30) - ideas.msu.ru/ )

... НАШ ФАКУЛЬТЕТ . ... Учебный отдел . ... Комплексное социологическое исследование: ?Современная система высшего образования глазами студентов, аспирантов и профессорско-преподавательского состава МГУ имени М.В. Ломоносова? ... Представляем Вашему вниманию программу 24-й секции ?Социальные исследования и современность?, которую проводит Высшая школа современных социальных наук МГУ имени М.В. Ломоносова. ... Copyright 2016 Высшая школа современных социальных наук (факультет) МГУ имени М.В.Ломоносова. ...

Еще в разделе: (Показать все результаты (>18) - vshssn.msu.ru/ )

... The modulation of wavevector of surface plasmons leads to enhancement of transversal magneto-optical Kerr effect ( TMOKE ), which has been recently observed in nickel nanogratings,3 in ferrite-garnetnoble metal grating4 or in Au/Co/Au multilayer structures.5 These magnetoplasmonic structures support both magnetooptical and plasmonic properties and allow using TMOKE as a probing tool for ... This difference from the Bragg plasmons proves a mixed origin of these plasmonic excitations. ...

Еще в разделе: (Показать все результаты (>47) - nanolab.phys.msu.ru/ )

• http://nanolab.phys.msu.ru/sites/default/files/optexp20_10538_2012.pdf
• http://nanolab.phys.msu.ru/sites/default/files/jap111_07a946_2012.pdf
• http://nanolab.phys.msu.ru/sites/default/files/jap111_07a944_2012.pdf

. Name . Last modified . Size . Description . about_center/ . 14-Sep-2013 14:31 . - . sections/ . 31-Oct-2007 14:46 . - . Apache/2.2.16 (Debian) Server at educenter.sinp.msu.ru Port 80

Еще в разделе: (Показать все результаты (>9) - educenter.sinp.msu.ru/ )

... We present some results of new calculations of D" ( t ) the second derivative of the Moon's elongation as a function of time. ... Let X be a set of all preserved recordings of observations of ancient Sun and Moon eclipses (see the list in [ 2 ], pp. 167 271): let A be a set of eclipses described in X (any eclipse a A may have some records corresponding to it and form X ( a )). ... The recount of dates t ( a 0 ), a 0 A ,( 700) < t ( a 0 ) < (+400), was first made by N. A. Morosov. ...

Еще в разделе: (Показать все результаты (>104) - hbar.phys.msu.ru/ )

• Historical Eclipses
• R.R.Newton, "Astronomical evidence..."

MSU Scientific Library Physics Faculty Library . UDK: universal decimal classification . ... Bible at Gateway.com (available different languages) Bible Bible-center . The list of literature links . ... William Burroughs see also William Burroughs . Library Network . Kharuki Murakami Kharuki Murakami. ... Different funny stories . Perseus Project (Perseus is an evolving digital library, engineering interactions through time, space, and language.) ... The Public's Library . ...

Еще в разделе: (Показать все результаты (>8) - astrometric.sai.msu.ru/ )

. - Астрономическое образование с сохранением традиций . ФОТОГАЛЕРЕЯ ПОЕЗДОК В САО . Лето 2004 года . 1 страница 2 страница . Предпоследний день в САО. Прощальные шашлыки и лошадки. Copyright 2004 WebMaster All rights reserved.

Еще в разделе: (Показать все результаты (>6) - heritage.sai.msu.ru/ )