... ICONO Invited Speakers . ... Gennadiy Kulipanov, Budker Inst. of Nuclear Physics, Russia . ... Marlan Scully, Texas A&M Univ., ... Andrey Goncharov, Inst. of Laser Physics, Russia . ... Vladimir Trunov, Inst. of Laser Physics, Russia . ... Since 1987, he has worked at the National Research Council of Canada (Ottawa) in the field of laser physics and trapped ion optical frequency standards. ... Alexey Taichenachev , Inst. of Laser Physics, Russia . ... S. Vatnik, Inst. of Laser Physics, Russia . ...

Еще в разделе: (Показать все результаты (>11) - iconolat13.phys.msu.ru/ )

яЛП . id #433 . Theory and Practice of Object Systems [not defined] . Common information . Periodicy: . [no information] . Impact-Factor: . [no information] . ISSN: . 1096-9942 . In print: . since 1997-01-01 till 1999-12-31 . Language: . en . Price: . single article - $1 . Classifier: . [no at all] . Comment: . Ceased. Published by . (4) . Wiley Interscience - roboUpdate . No homepage defined . No open resources defined . Close . Complain . Edit

Еще в разделе: (Показать все результаты (>21) - journals.genebee.msu.ru/ )

Elena V. Stenina . ... Department of Electrochemistry . ... Thesis: "Two-dimensional condensation of organic substances at electrode/solution interface and its role in electrochemical kinetics" . ... Junior Scientific Researcher, Senior Teacher, Senior Scientific Researcher, Leading Scientific Researcher, Department of Electrochemistry, Chemistry Faculty of Lomonosov Moscow State University . ... Investigation of adsorption at electrode/ solution interface and influence on electrochemical reactions". ...

Еще в разделе: (Показать все результаты (>81) - electr003.chem.msu.ru/ )

• Liana N. Sviridova:CV
• Maria A. Choba:CV
• Victor A. Safonov:CV

... Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures is very young. We have grown up in the laboratory of laser spectroscopy of water media. ... Use of such powerful modern tools of solution of inverse problems and problems of optimization provides successful solution of a wide range of applied problems of diagnostics and analysis of water media. ... 2016 Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures . ...

Еще в разделе: (Показать все результаты (>26) - rswater.phys.msu.ru/ )

... Russian-American Educational Exchanges Alumni Association "Professoinals for cooperation" . Ulyanovsk State University . USIA ALUMNI CONFERENCE . ACADEMICS AND UNIVERSITIES OF RUSSIA IN THE TRANSITIONAL PERIOD" . ... Bazhanov Valentin, Tel.: (8422)695728, 329316 e-mail: bazhan@bazh.univ.simbirsk.su , bazhan@sv.uven.ru . ... USIA ALUMNI CONFERENCE "Academics and Universities of Russia in the Transitional Period" Ulyanovsk, September, 17-20, 1998 . ... E-mail: . Home University: . ...

Еще в разделе: (Показать все результаты (>154) - www.prof.msu.ru/ )

• SYSTEM INTERFACE AND SYSTEM COUPLING: ANDY WARHOL AND ART MACHINE
• INTERNET AND DEMOCRACY
• Conditons of democratization of youth work

... How is FP7 made up? FP7 is made up of 4 main blocks of activities forming 4 specific programmes plus a fifth specific programme on nuclear research : Cooperation - Collaborative research · Health · Food, Agriculture and Biotechnology · Information and Communication Technologies · Nanosciences, Nanotechnologies, Materials and new Production Technologies · Energy · Environment (including climate change) · Transport (including Aeronautics) · Socio-economic sciences and Humanities ...

Еще в разделе: (Показать все результаты (>37) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/Decision_fp7.pdf
• http://ideas.msu.ru/docs/CSA_guide_2008.pdf
• http://ideas.msu.ru/docs/work_programme_2012.pdf

THE THIRD ANNUAL STUDENTS' SCIENTIFIC CONFERENCE ON TODAY'S TOPICAL POLITICAL AND PHILOSOPHICAL ISSUES Panel of philosophy ALEXANDER BOURGANOV AND HIS `NEW ROMANTICISM' CONCEPTION Liyamina Anastasiya Faculty of philosophy 1st year student Alexander N. Bourganov occupies an important place among famous masters of modern sculpture. ... He tries to find philosophical foundation for mathematics. ... Existential dread is examined by Kierkegaard in his work "The concept of anxiety". ...

Еще в разделе: (Показать все результаты (>92) - ffl.msu.ru/ )

• About Us

... defmacro defprinter ( name args &body body ) . ... body ) ) . ... defprinter :property ( type name &rest body ) . print-statement-with-body stream body nil "public ~a ~a" type name ) ) . ... defprinter :get ( &rest body ) . print-statement-with-body stream body nil "get" ) ) . ... defprinter :constructor ( name args &rest body ) . ... defprinter :class ( name &rest body ) . print-statement-with-body stream body t "public class ~a" name ) ) . ... defprinter :namespace ( name &rest body ) . ...

Еще в разделе: (Показать все результаты (>4) - depni.sinp.msu.ru/ )

... Reports on progress and error are always recorded in the log file of the program. ... UT date of the measurement finish in YYYY-MM-DD format UT time of the measurement finish in hh:mm:ss format Average flux in A aperture Average flux in B aperture Average flux in C aperture Average flux in D aperture Normalized variance of flux in A aperture Normalized variance of flux in B aperture Normalized variance of flux in C aperture Normalized variance of flux in D ...

Еще в разделе: (Показать все результаты (>22) - curl.sai.msu.ru/ )

• http://curl.sai.msu.ru/mass/download/doc/sv_ug.pdf
• http://curl.sai.msu.ru/mass/download/doc/dimm_soft_description.pdf

Contents Curricula, and Programs. Mathematical Analysis. (The Program of Mathematical Physics Department).............................................. Algebra and Analytical Geometry.(The program of (General "Mathematics" Department)................................ Computer and Programming. (The program of Algorithmic Languages Department).................................... The practical work on Computers.( Department of Algorithmic. Languages)............................................... Discrete

Еще в разделе: (Показать все результаты (>3) - mph.cmc.msu.ru/ )

... A comparative study of thermodynamic for both natural and artificial RNA/DNA ­ protein complexes would establish bases for a specificity of complex formation. In particular, we have shown that aptamers could be used for a direct measuring of thrombin enzymatic activity in a solution. D 2002 Published by Elsevier Science B.V. Keywords: RNA/DNA ­ protein interactions; Ribosome; SELEX; RNA/DNA aptamers; Thrombin; Enzymatic activity 1. ... The aptamer binds to the protein with Kd = 0.5 nM. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.ru/pages/pdf/nar2004.pdf

... Linguistic expeditions . ... The expeditions worked in different villages with Selkup, Ket, Evenki, and Forest Nenets population of the Pur and Krasnoselkup districts of the Yamalo-Nenets autonomous area, and of the Turukhansk and Evenki districts of the Krasnoyarsk Territory. The expeditions were supported by Russian Foundation for Basic Researches and Russian Foundation for the Humanities. ... Students of Russian State University for the Humanities took part in the expedition. ...

Еще в разделе: (Показать все результаты (>15) - lcl.srcc.msu.ru/ )

... Accepted input types are: A sequence in FASTA format begins with a single-line description, followed by lines of sequence data. ... Sequences are expected to be represented in the standard IUB/IUPAC amino acid and nucleic acid codes, with these exceptions: lower-case letters are accepted and are mapped into upper-case; a single hyphen or dash can be used to represent a gap of indeterminate length; and in amino acid sequences, U and * are acceptable letters (see below). ...

Еще в разделе: (Показать все результаты (>179) - www.genebee.msu.ru/ )

• GeneBee BLAST 2.2.8 Services Help
• RNA secondary structure prediction
• Screening pattern or alignmemt against PROTEIN databank

... One of the project objectives was to investigate practical efficiency of some modern iterative methods, including multigrid techniques and domain decomposition methods as well as methods for small compressible materials. ... Hence, the project research initiated because of INTAS financial support contributes in setting up modern computational techniques in tire design. ... Research on efficiency of iterative methods was conducted at the department of Mechanics of Composites about ten years ago. ...

Еще в разделе: (Показать все результаты (>3) - composite.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

... Геология >> Геотектоника | ... Добавить новое сообщение . ... Учебное пособие "Введение в тектонофизику". Гончаров М. А., Талицкий В. Г., Фролова Н. С. Ответ. ... Тезисы научной конференции ЛОМОНОСОВСКИЕ ЧТЕНИЯ, ноябрь 2011 года СЕКЦИЯ ГЕОЛОГИЯ: . ...

Еще в разделе: (Показать все результаты (>5) - phys.web.ru/ )

... Ярмарка вакансий и стажировок для студентов и выпускников вузов . ... Вакансии . ... Learning and Understanding HP and 3rd party software solutions, including architectures, development practices, frameworks, methodologies, SDK's, additional programming languages and tools as necessary, etc . ... Development of test plan, unit tests, integration, system and acceptance tests, basing on functional specification and user requirements, architectures, development schedules and project plans . ...

Еще в разделе: (Показать все результаты (>104) - www.physcareer.ru/ )

• Стажер-исследователь (Data Mining, Machine Learning) / Стажировки /
• Software Development Engineer - Student/Intern / Вакансии / Physcareer.ru

... Authors: Emily M. Levesque et al. arxiv:1406.0488 Компаньон с массой 1.05 солнечных для PSR J2222-0137: самый холодный из известных белых карликов? A 1.05 $M_\odot$ Companion to PSR J2222-0137: The Coolest Known White Dwarf?) ... Authors: Lidia M. Oskinova et al. обзор arxiv:1406.1357 Образование планет в двойных (Planet formation in Binaries) . ... обзор arxiv:1406.5604 Глобальные модели образования и эволюции планет (Global Models of Planet Formation and Evolution) . ...

Еще в разделе: (Показать все результаты (>205) - astro.uni-altai.ru/ )

• http://xray.sai.msu.ru/~polar/sci_rev/0604.html
• http://xray.sai.msu.ru/~polar/sci_rev/0702.html
• http://xray.sai.msu.ru/~polar/sci_rev/0409.html

The Database of Close Binary Systems . ... Team . ... This web-based interactive database is being developed and maintained by a team at the Sternberg Astronomical Institute of the Moscow State University . The project is an on-line extension of our catalogue on "Highly Evolved Close Binary Stars" (volumes I, II) published by Gordon and Breach in 1996. As of September 2009, the database (both the software and the content) is in its development/testing phase. ...

Еще в разделе: (Показать все результаты (>3) - dionis.sai.msu.ru/ )

Andreenko Alexander Stepanovich . Doctor of Physics and Mathematics(1994), . ... Magnetism, rare earth alloys and compounds, amorphous alloys, phase transitions. ... In 1971-1984 investigations of magnetocaloric effect in rare earth metals, compounds and alloys were taken. ... In 1980-1999 researches of magnetic and magnetoelastic properties of rare earth alloys were produced. ... Several Publications: 1) Andreenko A.S., Zvezdin A.K., Nikitin S.A., Popkov A.F. JETF, 1979,76,6, 2158-2165 . ...

Еще в разделе: (Показать все результаты (>11) - ferro.phys.msu.ru/ )

• Special courses for the students of Physics Faculty, specialized at the...