... Танцевальный коллектив Культурного Центра МГУ имени М.В. Ломоносова выиграл Чемпионат Европы среди ансамблей . ... В категории International Formation Dance Standard, представляя Россию, выступил коллектив Культурного Центра Московского государственного университета имени М.В. Ломоносова "Грация". ... Танцевальный клуб 'Грация МГУ' является структурным подразделением Культурного Центра МГУ имени М.В. Ломоносова. ... 2003 2011 MsuNews.Ru Новости МГУ . ...

Еще в разделе: (Показать все результаты (>18) - www.msunews.ru/ )

• MsuNews.Ru | Новости МГУ | В рамках проекта 'Generation next' британская
• MsuNews.Ru | Анонсы и объявления | 'Лаборатория Касперского' приглашает
• MsuNews.Ru | Анонсы и объявления

. Copyright . * : ' + ' - available in the standard database (NSDB) . Credit

Еще в разделе: (Показать все результаты (>21) - www.sai.msu.ru/ )

LabVIEW. ... National Instument DAQ, LabVIEW LPT COM , GPIB . ... RS-232 GPIB . RS-232 / GPIB, LabVIEW. ... RS-232 IEEE-488 (GPIB). ... RS-232 , DTE (Data Terminal Equipment) -- ( ), -- DCE (Data Communications Equipment) -- ( ). DTE () -- , DCE () -- , RS-232 (, , ), . ... LabVIEW, National Instruments http://ni.com/support/gpib/versions.htm. ... VISA Read COM Receive GPIB ), , . VISA Write Send COM GPIB . ... VISA Read Receive , «read buffer» ( «data string» GPIB) Create\Indicator. ...

Еще в разделе: (Показать все результаты (>4) - www.test.physchem.msu.ru/ )

A Dictionary of Units . ... yotta [Y] 1 000 000 000 000 000 000 000 000 = 10^24 zetta [Z] 1 000 000 000 000 000 000 000 = 10^21 exa [E] 1 000 000 000 000 000 000 = 10^18 peta [P] 1 000 000 000 000 000 = 10^15 tera [T] 1 000 000 000 000 = 10^12 giga [G] 1 000 000 ... cubic (+ any units) . ... This unit also has the great advantage of being numerically unchanged for grams/cubic centimetre and tonnes/cubic metre (or megagrams/cubic metre). ...

Еще в разделе: (Показать все результаты (>80) - www.kosmofizika.ru/ )

• Frequently Seen Space/Astronomy Acronyms

... The Sixth International Conference «Scientific Issues in Security and Combating Terrorism », Moscow, 11 - 12th of November, 2010 The Council of Europe approach to the international information security in the context of the fight against terrorism Ms. Marta Requena, Head of the Public International Law and Anti- Terrorism Division Head of the Counter Terrorism Task Force, Council of ... States certainly remain the principle actors of the fight against terrorism. ...

Еще в разделе: (Показать все результаты (>4) - www.iisi.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

... On-line консультант . ... Приглашаем всех, интересующихся исследованиями и разработками в области компьютерных сетей, принять участие в семинаре по software-defined networking, который состоится 4 июля 2011 (понедельник) в 19.30 в Политехническом музее (Новая площадь, д 34;, подъезд 9, малая аудитория). ... We are about to witness a revolution in the networking towards so-called "Software Defined Networking" (SDN). SDN enables innovation in all kinds of networks . ... Copyright ВМиК МГУ , 2008 . ...

Еще в разделе: (Показать все результаты (>5) - erp.cmc.msu.ru/ )

WINAMP . playlist . 243 tracks in playlist, average track length: 3:33 . ... 161 tracks of unknown length) . ... Dj cyraX - Babyboom's Tracks . Dj cyraX - Bad Vibes Tracks . cyraX - Cenobite's Tracks . ... Track 01 . ... XD 400 Operating System.mp3 . ... XOL DOG 400 Aural Destroyer.mp3 . XOL DOG 400 Babytesting.mp3 . XOL DOG 400 Ctulluh.f.mp3 . XOL DOG 400 Tetaliquid.mp3 . XOL DOG 400 The Chair .mp3 . XOL DOG 400 The Plan.mp3 . ... Matt Terror - Angstschweiss . ...

Еще в разделе: (Показать все результаты (>13) - optics.sinp.msu.ru/ )

... Let the control system be given by the equation dx = X (x, u) = X, u U, dt where X is a vector field on the configuration space M , x M , u is the control parameter, U is the set of admissible values of u. With the vector field X we canonically associate a scalar-valued fiberwise linear function HX on the cotangent bundle T M , HX ( , u) = , X ( , u) , T M , u U, where : T M - M is the canonical pro jection. ...

Еще в разделе: (Показать все результаты (>15) - pont2008.cmc.msu.ru/ )

• http://pont2008.cs.msu.ru/files/en/abstracts/Ray.pdf

... Electronic journal Issue 4. 10 september 2004 Briedis V. Pareto Structures A great Italian economist Vilfredo Pareto (1848 ­ 1923) in his unique economics and sociology studies [1, 2] continuously emphasised the systematic approach, reviewing the society development problems. ... Formal model of Pareto Structure First of all, provide a formal mathematical model adequately featuring the Pareto Structure. ... Indeed, I was primarily interested in the classical (harmonic structure) model at s = 1. ...

Еще в разделе: (Показать все результаты (>8) - e-journal.spa.msu.ru/ )

• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./vorontchuk.pdf

Optical Transport N etwork (OTN) Tutorial Disclaimer: This is a Tutorial. This is NOT a Recommendation! This tutorial has no standards significance. It is purely for educational purposes. In case of conflict between the material contained in the tutorial and the material of the relevant Recommendation the latter always prevails. This tutorial should NOT be used as a reference; only the relevant Recommendations can be referenced. Summary This document provides a tutorial for Optical Transport Network stand

Еще в разделе: (Показать все результаты (>7) - lvk.cs.msu.su/ )

• http://lvk.cs.msu.su/~bahmurov/course_realtime/papers/balashov_et_al_eucass2011_monitoring.doc
• http://lvk.cs.msu.su/~sveta/SDN_OpenFlow_controllers_lecture2.pdf

MPI. ... C: #include <mpi.h> 14 MPI MPI- C (case sensitive): error = MPI_Xxxxx(parameter,.. ... Send : , , ­ Receive: , , 27 MPI () MPI - , (blocking) (non-blocking) ­ Blocking: ­ Non-blocking: , 28 MPI (modes) (Mode) Synchronous send Buffered send Standard send Ready send Receive (Completion Condition) ( ), ( ) ( ), 29 MPI «-» () (MODE) Standard send Synchronous send Buffered send Ready send Receive MPI MPI _ Send MPI _ Ssend MPI _ Bsend MPI _ Rsend ...

Еще в разделе: (Показать все результаты (>3) - angel.cmc.msu.ru/ )

Third Harmonic Generation in Fishnet Metamaterials M. R. Shcherbkov1, J. Reinhold2, A. S. Shorokhov1, A. Chipouline2, C. Helgert2, T. Pertch2, A. A. Fedyanin1 1 Faculty of Physics, Lomonosov Moscow State University, 119991 Moscow, Russia 2 Friedrich-Schiller-UniversitДt Jena, 07743 Jena, Germany shcherbakov@nanolab.phys.msu.ru Abstract: Optical third harmonic generation in gold-based fishnet metamaterials is studied. ...

Еще в разделе: (Показать все результаты (>69) - nanolab.phys.msu.ru/ )

• http://nanolab.phys.msu.ru/sites/default/files/nl503029j3.pdf
• http://nanolab.phys.msu.ru/sites/default/files/acsphotonics.pdf
• http://nanolab.phys.msu.ru/sites/default/files/paper_nonlinear.pdf

About SPAW Editor . ... As of final version 1.0 of the control you'll need to rename the file spaw_control.default.config.php in config sub-directory to spaw_control.config.php when installing control for the first time. ... All of the SPAW Editor configuration options are located in the config/spaw_control.config.php file. ... This file will be included in img_library.php (Image library dialog script). $request_uri variable will be set to the URL of the page where SPAW Editor instance resides. ...

Еще в разделе: (Показать все результаты (>3) - textbook.sinp.msu.ru/ )

February 11, 1997 Neurokinetics Case Study Background 2 The Bionic Glove 2 Details 2 Development 3 Commercialization 4 The Issues 4 Intellectual Property 4 The Market 5 Distribution 7 Clinical Trials 7 Product Development 9 Regulatory Considerations 10 Sales Projections 11 Financing 12 Commercial ... Research indicated that the target market for Canada and the United States combined was approximately 76,850 existing patients with 2,850 new patients anticipated each year. ... patients | ...

Еще в разделе: (Показать все результаты (>37) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/english/pointstoconsider.doc

Journal of Biotechnology 58 (1997) 187 ­ 195 Rapid SDS -GEL capillary electrophoresis for the analysis of recombinant NADP + -dependent formate dehydrogenase during expression in Escherichia coli cells and its purification V. Klyushnichenko *, V. Tishkov, M.-R. Kula Institute of Enzyme Technology, Heinrich -Heine Uni6ersity Dusseldorf, D -52426 Julich ... Purification of FDH 2. ... Klyushnichenko, V., Kula, M.-R., 1997a. Rapid SDS Gel Capillary Electrophoretic analysis of proteins. ...

Еще в разделе: (Показать все результаты (>119) - www.enzyme.chem.msu.ru/ )

• Tetrahedron Letters : A Novel, Efficient Regenerating Method of NADPH Using a
• PubMed medline query

... Here we construct a general approach to formulating and using embedding formulae, we do this using complementary approaches: overly singular states, and a physical interpretation in terms of sources. ... For example, if the obstacle is a planar crack in the medium, then the auxiliary problems are associated with the excitation of the field by a point source located asymptotically close to the edge of the crack. ... That is, has overly singular behaviour at the edge. ...

Еще в разделе: (Показать все результаты (>47) - acoustics.phys.msu.ru/ )

• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/valyaev10.pdf
• http://acoustics.phys.msu.su/teachers/gordienko_files/localization_eng.pdf
• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/craster_shanin02a.pdf