1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

4 SPIN. ... 0 1 Hello, world! ( ) ";" , active proctype main() { printf("Hello, world!\n") } ґ , >spin hello.pml Hello, world! 1 process created Hello, world! ... mtype = { P, C }; mtype turn = P; active proctype producer() { do :: ( turn == P) - printf( Produce\n ); turn = C od } active proctype consumer() { do :: ( turn == C) - printf( Consume\n ); turn = P od } ( 1) ґ 0, (op on sequence) (guard) ґ mtype = { P, C }; mtype turn = P; active proctype producer() { do :: ( ...

Еще в разделе: (Показать все результаты (>4) - savenkov.lvk.cs.msu.su/ )

• http://savenkov.lvk.cs.msu.su/mc/lect02.pdf

... A new original method of information processing and secure communications based on the coding of alphabet symbols by stabilized cycles of certain perturbed one-dimensional dynamical systems is proposed. The foundation of the proposed method is ciphering by the one-to-one correspondence between periods of such cycles and certain alphabet symbols. ... We propose an original method of data encoding, which makes use of the possibility of stabilizing the cycles of chaotic maps. ...

Еще в разделе: (Показать все результаты (>73) - chaos.phys.msu.ru/ )

• Research interests

... Fast Facts about the Faculty of Journalism . ... Academic Departments . ... Full-time programs . ... Partners . ... All partners . ... Attraction of international students, development of cooperation with foreign partner universities is one of the priorities for the Faculty of Journalism. ... Foreign citizens can enter the Faculty of Journalism on a contract basis according to specific rules. ... Faculty of Journalism provides foreign applicants with a standard visa invitation. ...

Еще в разделе: (Показать все результаты (>65) - www.journ.msu.ru/ )

• A public talk of Professor Nico Carpentier :: Department of Journalism, M. V.
• International academic conference 'Ethnic Press - Genesis, Structure,

Search of Novel Crystalline Materials , Study of their Properties and Crystallization Processes . ... The work of group for the search of novel crystalline materials are held at M.V. Lomonosov Moscow State University since 1964. The main aim of investigations are search and study of new promising multifunctional materials with unusual physical properties: ferroelectrics, superionic conductors, nonlinear optical materials, laser crystals, piezoelectrics, etc. ...

Еще в разделе: (Показать все результаты (>4) - newcryst.phys.msu.ru/ )

Moscow State Lomonosov University and Moscow Mathematical Society . ... Topology, analysis and applications to mathematical physics" . ... Geometry and topology, analysis, applications to mathematical physics . ... Moscow Mathematical Society, . ... Seminar on Topology and Analysis . ... Do you need an accomodation in Moscow: Yes No . Do you need a visa support: Yes No . If YES where do you intend to apply for the Russian Visa? ... to Organizing Committee by October 23, 2004 at the latest. ...

Еще в разделе: (Показать все результаты (>36) - dfgm.math.msu.su/ )

• Intro
• 1st Announcement

ВМиК-Online! ... Студенты . ... Выпускники . Работа . ... Западная пивная компания приглашает на работу на должность System Network Administrator. ... Опыт работы от двух лет. ... Опыт работы с сетевым оборудованием Cisco. ... Западная пивная компания приглашает на работу на должность SAP Basis/DB2 Administrator. ... МГУ . ... Рейтинг компаний составляется на основе данных Клуба выпускников МГУ . ... 2001 2012 ВМиК Online! ... Комментарии и предложения присылайте на адрес info@cmc online.ru . ...

Еще в разделе: (Показать все результаты (>7) - www.cmc-online.ru/ )

trendence Graduate Barometer Europe 2011 About the survey ґ About trendence trendence Graduate Barometer Europe is an annual online student survey which allows students to express their opinion on topics re lated to career and education. ... Ulrike Heyne Project Manager trendence Graduate Barometer Europe 2011 About the survey Facts and benefits How does it work? ... If your students take part in the trendence Graduate Barometer, they will receive an exclusive Student Report. ...

Еще в разделе: (Показать все результаты (>3) - studsov.math.msu.su/ )

Summary Progress Report 2010 ґ 2014 UNESCO Chair on Global Problems and Emerging Social and Ethical Challenges for Large Cities and Their Population at the Faculty of Global Processes of the Lomonosov Moscow State University Period of activity: September 2010 June 2014 Title of the Chair : UNESCO Chair on Global Problems and Emerging Social and Ethical ... Visit of UNESCO Director-General Irina Bokova at Moscow State University September 9, 2011. ...

Еще в разделе: (Показать все результаты (>115) - fgp.msu.ru/ )

• http://fgp.msu.ru/wp-content/uploads/2013/12/Luce_Moscow_2013_small.pdf
• http://fgp.msu.ru/wp-content/uploads/2014/03/Information-Sheet.pdf
• Search Results пєп?п? п?п?пе п?п?. п?.п?. п?пЎп?пЎпҐпЎя?пЎп?п°

... О факультете . ... The Second White Sea Molecular Zoology Summer School . ... N.A.Pertzov White Sea Biological Station (WSBS MSU) invites undergraduate and graduate students studying zoology and ecology to participate in summer field school on Molecular Zoology, which will take place in September 5-19, 2010. ... Overview of major groups of invertebrates inhabiting the White Sea, determination of species with taxonomic keys, primer on zoological drawings. ... Биологический факультет МГУ . ...

Еще в разделе: (Показать все результаты (>5) - www.bio.msu.ru/ )

• Master In Ecology ? Биологический факультет МГУ
• Master In Nanobiotechnology ? Биологический факультет МГУ

... Academic Programmes . ... Vestnik CIE (in Russian) . FAQs (in Russian) . ... About Moscow University . Links (in russian) . ... Test Your Russian ? ... Lomonosov Moscow State University . ... Day- -Month- -Year- . ... Choose- Male Female . ... Choose- -Other- . ... Russian language for academic purposes major subjects) . Course: . ... Choose- during academic year summer courses . ... Course dates: . ... Choose- professional training refresher course brief refresher course traineeship . ...

Еще в разделе: (Показать все результаты (>24) - www.cie.ru/ )

• Center for International Education - News Archive
• Alumni :: CIE

... Выпускники . Выпускники ВМиК . ... Женский клуб . ... Бейсбольный клуб . Айкидо-клуб . Дайв-клуб . ... Театр МГУ . ... Новости для выпускников . ... База данных выпускников . ... Выпускники МГУ . ... Дайв-Клуб МГУ . ... Now that Vancouver has won the chance to host the 2010 Winter Olympics these are some questions people the world over are asking!! Believe it or not these questions about Canada were posted on an International Tourism Website (frightening, isn't it!) ... USA) . ...

Еще в разделе: (Показать все результаты (>319) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Конференция "Вакансии"
• Клуб выпускников МГУ: Конференция "Выпускники МГУ в Канаде"
• Клуб выпускников МГУ: AGEING Dr.Sula - General Overview 2008

Nonlinear Dynamic Phenomena in Physiological Control Systems Mosekilde E. BioSim Coordinator EU Network of Excellence Department of Physics, Technical University of Denmark, Kgs. Lyngby, 2800, Denmark; e-mail: erik.mosekilde@fysik.dtu.dk The purpose of this talk is to demonstrate the essential role that nonlinear dynamic phenomena play in normal physiological regulation and in the development of various diseases. As an example we consider renal auto-regulation in normo- and hypertensive rats. ...

Еще в разделе: (Показать все результаты (>88) - www.msm.biophys.msu.ru/ )

• MSM 2007

... The factors that play the key role in complex formation are as follows: the rate of protein diffusion to the docking site; long-range electrostatic interactions between protein surfaces, geometric and chemical complementarity of binding areas; molecular mobility at the proteinґprotein interphase, hydrogen bonds, Van der Waals interactions, hydrophobic interactions, and salt bridges. ... Three-dimensional protein molecules are constructed on the basis of data extracted from the Protein Data Bank. ...

Еще в разделе: (Показать все результаты (>30) - www.library.biophys.msu.ru/ )

• MECHANISMS OF THE ACTION OF A LOW-FREQUENCY MAGNETIC FIELD ON THE INITIAL
• ФИЗИЧЕСКИЕ ПОДХОДЫ В ИССЛЕДОВАНИЯХ ДНК
• Fluorescence induction curves registered from individual microalgae cenobiums

... Lomonosov Moscow State Univ Research Center "Computer Science and Control" of RAS (FRC CSC RAS) Operations Research Society (RSORS) will organize the VIII Conference in Octo Operations Research. theoretical aspects and ersity (MSU), Federal and Russian Scientific ber 2016 in Moscow. ... Deadline for abstract submissions is March 31, 2016. ... Conference website: http://io.cs.msu.ru/ORM2016.html. ... Selected extended abstracts will be published in the Conference proceedings. ...

Еще в разделе: (Показать все результаты (>18) - io.cmc.msu.ru/ )

• http://io.cs.msu.ru/ORM2016/ORM2016-2nd_announ-ENG.pdf
• http://io.cs.msu.ru/translation2.pdf

miniSTRY OF HEALTHCARE AND SOCIAL DEVELOPMENT RF NORTHERN RESEARCH CENTER NORTH-WEST BRANCH RAMS federal service for hydrometeorology and environment monitoring (rosgidromet) MINISTRY OF HEALTHCARE AND SOCIAL DEVELOPMENT OF ARKHANGELSK REGION territorial administration of federal service for consumers' rights protection Surveillance and human well-being in arkhangelsk region NORTHERN STATE MEDICAL UNIVERSITY [pic] NEWSLETTER of the All-Russian Science-and-Practice ...

Еще в разделе: (Показать все результаты (>27) - www.anthropos.msu.ru/ )

. Numerical methods of research on heat and mass intensification processes in power units. Book ?Numerical simulation of vertical intensification of heat transfer in tube packages? . Numerical simulation results of heat transfer intensification on ?eddy generating? surfaces with different turbulence models application. Heat and hydrodynamic pattern at flowing over the cylinder with ?eddy generating? elements

Еще в разделе: (Показать все результаты (>6) - termogaz.imec.msu.ru/ )

... Each July we ::. to Turkey for a holiday. are going . ... He ::: quite different since we :: married. is/has got . ... What time:::tomorrow? . ... If you ::. careful with electricity, you might get a shock. don't . ... had got to get . ... There were too much . ... b) What do you use your computer for? . ... g) Do you see yourself as a computer geek ? ... But as a true technobimbo , I really hate the way computers get stuck, go wrong and generally fail to explain themselves in plain English. 4. ::::...

Еще в разделе: (Показать все результаты (>21) - www.eng.math.msu.su/ )

... The technique had been developed for calculating destruction of melting vitreous bodies in hypersonic gas flows taking into account the internal radiative transfer. ... The problem of flow in the chemically non-equilibrium boundary layer at a stagnation point of blunt body had been solved by the asymptotic method and formulas for the heat and diffusion fluxes to a surface of any catalycity had been obtained. ...

Еще в разделе: (Показать все результаты (>6) - lab106.imec.msu.ru/ )