... 2 · ­ , , · ­ · ­ , 03.12.2015 . ... 14 03.12.2015 · · · 03.12.2015 . ... Verifier Uni ve rsi ty of Te x as 2013 Anteater Uni ve rsi ty of Il l i noi s 2011 FlowChecker Uni ve rsi ty of North Carol i na 2010 VERMONT Network disjoint Port #02 Port #03 h2 h3 s1 Port #01 h1 Port #04 h4 main: disjoint() := Forall[x, out_x, y, out_y: !R(x, out_x) or !R(y, out_y) or x[p] == out_y[p] and out_x[p] == y[p] or x VERMONT proxy CLI Packets are delivered through the control plane We can block them! ...

Еще в разделе: (Показать все результаты (>7) - lvk.cs.msu.su/ )

• http://lvk.cs.msu.su/~bahmurov/course_simulation/2015/tut_ipm_01_gpss.pdf

... Study (Michael & Houchin 1979) is an example of one of the first nonparametric approaches to EEG segmentation. ... As we noted, the main disadvantage of this approach to segmentation was the lack of adaptability of segment boundaries to the actual piecewise stationary structure. ... One may also expect that the change-points can reveal the consecutive operations of neuronal networks, with different time scales according to parameters of the algorithm of change-point detection (Kaplan et al. 1997b). ...

Еще в разделе: (Показать все результаты (>61) - brain.bio.msu.ru/ )

• Change-points at different levels of the hierarchy of EEG segmental...
• Change-points in multi-channel EEG
• Change-points in EEG components with different pattern

... В левой части открывшегося окна Group Policy найдите раздел Local Computer Policy | ... Windows Update . ... Дважды щелкните по строке Configure Automatic Updates , в открывшемся окне поставьте переключатель в положение Enabled. ... Задав настройки для параметра Configure Automatic Updates, щелкните Next Policy и в окне Specify intranet Microsoft update service location Properties поставьте переключатель в положение Enabled, а в обоих полях ввода текста обязательно введите http://wsus.chem.msu.ru . ...

Еще в разделе: (Показать все результаты (>2) - netadmin.chem.msu.ru/ )

... Many presentations concern interesting work, but are nevertheless difficult to follow because the speaker unknowingly makes a number of presentation errors. ... Time 1 Conclusion Audience Attention Introduction Various Themes Efficient Presentation Intermediate Conclusion Intermediate Conclusion Average Presentation Figure 2 Ideal attention curve of an audience when the speaker divides his talk in recognizable parts, each summarized by intermediate conclusions. ... What is a successful poster? ...

Еще в разделе: (Показать все результаты (>30) - www.kge.msu.ru/ )

• IVAKIN YURY DMITRIEVICH

4 SPIN. ... 0 1 Hello, world! ( ) ";" , active proctype main() { printf("Hello, world!\n") } ­ , >spin hello.pml Hello, world! 1 process created Hello, world! ... mtype = { P, C }; mtype turn = P; active proctype producer() { do :: ( turn == P) - printf( Produce\n ); turn = C od } active proctype consumer() { do :: ( turn == C) - printf( Consume\n ); turn = P od } ( 1) ­ 0, (op on sequence) (guard) ­ mtype = { P, C }; mtype turn = P; active proctype producer() { do :: ( ...

Еще в разделе: (Показать все результаты (>4) - savenkov.lvk.cs.msu.su/ )

... Geography of World Economy . ... Recreational Geography and International Tourism . ... Physical Geography and Landscape Science . ... Field stations . ... Educational council . Science . ... International commission on continental erosion . ... Field training . ... Type of field courses . ... Interuniversity council for erosion and fluvial.. ... International programme in Natural Resource Management and Law offers a unique combination of Natural and Environmental Sciences and Science of Law. ...

Еще в разделе: (Показать все результаты (>110) - eng.geogr.msu.ru/ )

• Interdisciplinary seminars
• Department of Land Hydrology
• Department of Meteorology and Climatology

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

... Таня Трубичева, Коля Чеботарев, Сергей Меженный, Андрей Лебедев . ... Слева направо: Паша Зинюков, Булат Мавлюдов, Галя Ивутина (выше), Муся Григорян, Саша Игнатьев. ... Слева направо: 1)Аня Ноздрачева, 2)Дима Китаев, 3)Миша Ноздрачев, 4)Женя Цибиков, 5)Костя Фирсов, 6)Володя Трифонов, 7)Тамара Голубицкая, 8)Таня Михайлина, 9)Саша Игнатьев, 10)Валя Рябинкина, 11)Таня Чеботарева, 12)Оля Гусева, 13)Коля Чеботарев. ... Таня Гужва, Таня Немченко, Даниэль Усиков перед спуском в снежную . ...

Еще в разделе: (Показать все результаты (>12) - optics.sinp.msu.ru/ )

• polist99
• zagedan

Moscow Astronomical Plate Archives: . Contents, Digitization, Current and Possible Applications . ... We describe the astronomical plate archives in Moscow and Zvenigorod and the existing digitization projects. ... 2 The Plate Archive of the Sternberg Institute . The contents of the most important Moscow astronomical plate archive, that of the Sternberg Astronomical Institute, was briefly presented in Shugarov et al. [1] in 1999. ... THE MOSCOW PLATE COLLECTION (STERNBERG INSTITUTE) . ...

Еще в разделе: (Показать все результаты (>27) - www.sai.msu.ru/ )

• Index of /groups/cluster/gcvs/digit/mdv
• Отдел внегалактической астрономии: ГАИШ Extra-galactic astronomy Group Staff

Session Start: Thu Sep 04 15:17:41 1997 . ASA_ECTb> Уж приходит дождливая осень . JamOUT> На окне - капли стылые дня . ... Master_> О чем сказал? ... Valka> где кажется весь мир земной . Sol> избавлен от ночной проказы . ... Sol> значит, далеко еще метели. ... Sol> значит снова ветер дует в грудь, . ... Master> Значит снова наступил рассвет . Valka> Значит не один на этом свете, . ... ASA_ECTb> Значит, Бог судьбу твою отметил . Master> Значит жить нам вместе много лет. ...

Еще в разделе: (Показать все результаты (>19) - asa.guru.ru/ )

• Буриме от 5 сентября 1997 года
• Буриме от 11 сентября 1997 года
• Буриме от 11 ноября 1997 года

Запись фильма . Запись фильма в программе WinView/32 . Версия 2.2.1.10 . 1998, Princeton Instruments Inc . ... верхнее положение - синхронизирован с камерой . среднее положение - закрыт . нижнее положение - открыт . Настройки программы для записи фильма . Experimental Setup . ... Number of images (число кадров фильма) ? ... CCD readout use region of interest . Accumulation 1 . ... overwrite/append append to . 3) ROI setup . ... end, end x/4 . ...

Еще в разделе: (Показать все результаты (>29) - cellmotility.genebee.msu.ru/ )

. Click here to start INTAS 95-525 main page.

Еще в разделе: (Показать все результаты (>4) - composite.msu.ru/ )

• INTAS 95-525 Final Reprort (Short version)

About Department of Crystallography and Crystal Chemistry . Department of Crystallography and Crystal Chemistry was founded in Lomonosov Moscow State University by Correspoding Member of USSR Academy of Sciences Prof. G.B. Bokii in 1949. ... During all the time X-ray crystal structure determination of new minerals and their synthetic analogues remains the major part of scientific researches of the Department. ... Prof. N.N. Eremin), X-ray diffraction and crystal structure analysis (Prof. D.Yu. ...

Еще в разделе: (Показать все результаты (>14) - cryst.geol.msu.ru/ )

... ENGLISH LITERATURE QUIZ Circle the letter which corresponds to the correct answer in the following questions: 1. The starting point of English Literature is the ..... a) 5th century century 2. ... Henry Howard, Earl of Surrey a) introduced the genre of sonnet into English literature b) translated Petrarch`s sonnets into English c) modified the traditional form of the sonnet 5.The main poetic device used by Christopher Marlowe in his plays was a) rhyme b) blank verse c) Spencerian stanza 6. ...

Еще в разделе: (Показать все результаты (>127) - ffl.msu.ru/ )

• Contact Us
• About Us
• International Students

... Home > Open Conference Systems . ... History of the ICONO series goes back to 1965 and the LAT series of the conferences started in 2002. ICONO/LAT 2016 will be held in Minsk, the capital and largest city in Belarus, The oldest mentions of Minsk date back to 1067. In 1242 Minsk became a part of the Grand Duchy of Lithuania and received its town privileges in 1499. ... During 1919-1991 Minsk was the capital of the Soviet Belarus, which became in 1991 an independentб  state. ...

Еще в разделе: (Показать все результаты (>18) - hea.phys.msu.su/ )

• Call for Papers
• Browse Title Index

Dear friends, It is less than three weeks left till the 39th IChO starts. ... Currency and cards. Russian rouble is the only currency accepted throughout Russia. ... To attention of Head mentors intending to pay fees on arrival in cash: payments will be accepted in Russian roubles only. ... During the IChO, mentors and guests will stay in Holiday Inn Sokolniki, and students in the Olympian camp, which is also an option for early arrivals and late departures. ... The 39th IChO Organizing Committee ...

Еще в разделе: (Показать все результаты (>2) - icho39.chem.msu.ru/ )

• 39th INTERNATIONAL CHEMISTRY OLYMPIAD

... Molecular Physiology ? ... The head of the course is Professor M. Ostrovsky, Full Member of RAS, Head of the Chair of Molecular Physiology, Head of the Laboratory of Emanuel Institute of Biochemical Physics, RAS, President of Pavlov Physiology Society. ... Introduction to Molecular Physiology. ... Prof. M. Ostrovsky, Full Member of RAS) . ... Prof. E. Grishin, Corresponding Member of RAS) . ... Prof. E. Nikolsky, Corresponding Member of RAS) . ... Prof. L. Rozenshtraukh, Full Member of RAS and RAMS)...

Еще в разделе: (Показать все результаты (>17) - nano.msu.ru/ )

• Announcement about the admission to MSU Graduate School for a new Master?s

Contemplating the evolution of Surface Nonlinear Optics seems to be highly instructive, able to stimulate one's own creativity and deeper understanding of current trends in this field. ... Hence, the Surface Nonlinear Optics Map, in its starting version, presents the names of researchers having made prominent scientific contributions to this branch of Optics. Related websites are accessible by clicking the corresponding names. ...

Еще в разделе: (Показать все результаты (>25) - shg.phys.msu.ru/ )

• Milestones of the lab highway

e-mail: inna_ver@rambler.ru) , , , , , , , society, Agent, System, Structure, Structuration, globalization, radical modern . The article is devoted to the analysis of the theory of structuration viewed as the basis for the work of A. Giddens, the British sociologist. ... The theory of structuration is interpreted as the basis for A. Giddens's analysis of modern society, the latter characterised by the British sociologist as radical modern. ...

Еще в разделе: (Показать все результаты (>47) - vestnik.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/archive/2012/1/13.pdf

... This information is needed for description of interaction of atom and ion with charge particles and photons. ... The project calculations are based on variational method and wave function expansion in a linear combination of hydrogen - like functions with effective charges. wave function of atoms, wave function of ions, cross section calculations, helium-like, variational method, Hartree - Fock, excited states, ionization, single excitation, double ionization, double excitation . ...

Еще в разделе: (Показать все результаты (>56) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Calculator and Graph Engine for Atomic Nuclei
• Index of /services/wftables
• CDFE => Online Services => Nucleus Ground State Parameters