... О кафедре . ... Завершился курс "Методы лабораторных зоологических исследований", впервые проводимый в этом году. ... 11-й Морской семинар! Продолжить чтение . 31 марта 2016 (четверг), 13:00, 594 ауд. - заседание кафедры . ... Десятый семинар центра морских исследований МГУ . ... Девятый семинар центра морских исследований МГУ . ... JavaScript must be enabled in order for you to use Google Maps. However, it seems JavaScript is either disabled or not supported by your browser. ...

Еще в разделе: (Показать все результаты (>3) - invert.bio.msu.ru/ )

• История кафедры
• Учебный процесс

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

RADIO EMISSION OF THE MOON BEFORE AND AFTER THE LUNAR PROSPECTOR IMPACT Berezhnoi A.A.*, Gusev S.G.**, Khavroshkin O.B.***, Poperechenko B.A.**, Shevchenko V.V.*, Tzyplakov V.A.*** * Sternberg Astronomical Institute, Universitetskij pr., ... For the registration of lunar RSR after the Lunar Prospector impact radio observations of the Moon on the two 64-m radio telescopes of the SDO MEI at Medvezh'i Ozera and Kaliazin were conducted during July 30 - August 2, 1999. ...

Еще в разделе: (Показать все результаты (>80) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Bus/Publications/m44_14_busarev_etal.pdf
• http://selena.sai.msu.ru/Symposium/maps.doc
• http://selena.sai.msu.ru/Shev/Publications/ms38/ms082.pdf

О лаборатории . ... Лаборатория теоретической биофизики . ... The script generates nanotubes of arbitrary structure. ... To use it, save script to some file, then load into PyMol with the command: run /path/to/script.py . ... Here comes the script : # Nanotubes generating script for PyMol by piton at erg .biophys.msu.ru import cmd from math import cos,sin,pi,ceil,floor, acos from chempy import models, cpv class cell: def __init__(self ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>23) - erg.biophys.msu.ru/ )

• Quantum chemistry information page ERG Research Group: Лаборатория

Setting Up a Pay System Canada Business Service Centres - CBSCs Last Verified: 2004-05-28 Document No. 4046 Summary Pay administration is a management tool that enables you to control personnel cost, increase employee morale, and reduce work force turnover. ... This publication provides time-tested concepts for determining competitive pay levels and for maintaining fair pay relationships among the jobs comprising a small company. ... appraise employee performance under the plan. ... job title; . ...

Еще в разделе: (Показать все результаты (>19) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/english/yourmarketingstrategy.doc
• http://www.innovation.msu.ru/english/marketingplanoutline.doc

... 40 (2007) 12033­12042 JOURNA L OF PHYSICS A: MAT HEMATICAL AND THEORETICAL doi:10.1088/1751-8113/40/40/002 Generalization of the DLA process with different immiscible components by time-scale coarse graining EBPostnikov1, A B Ryabov2 and A Loskutov2 1 Kursk State University ... September 2007 Online at stacks.iop.org/JPhysA/40/12033 Abstract In the framework of the mean-field approximation we propose a new approach to the description of the growth of ...

Еще в разделе: (Показать все результаты (>70) - chaos.phys.msu.ru/ )

• http://chaos.phys.msu.ru/loskutov/PDF/Galss_ceramics.pdf
• Loskutov's home page
• Dzhanoev's home page

Twilight observations with MASS/DIMM B. Safonov Sternberg Astronomical Institute Moscow State University Comprehensive Characterization of Astronomical Sites, 2010 B. Safonov (Moscow State University) Twilight observations with MASS/DIMM SITE 2010 1 / 17 Why observe in twilight with MASS/DIMM? ... ASM includes 3 devices sensitive to background: guider, DIMM and MASS. B. Safonov (Moscow State University) Twilight observations with MASS/DIMM SITE 2010 2 / 17 Background in guider. ...

Еще в разделе: (Показать все результаты (>11) - site2010.sai.msu.ru/ )

... Next Routine] [List of Routines] NAME: ADD_HEADER PURPOSE: addition information from FITS-headers MPFS-frames DESCRIPTION: The function computes the total exposure, mean value zenit distance and modified FITS header CALLING SEQUENCE: Result =ADD_HEADER( headers ) CATEGORY: reduction MPFS-data INPUTS: Headers = String array FITS-headers from the MPFS data OUTPUTS: Header = String array containing the header from the FITS file. ... OPTIONAL INPUT KEYWORD PARAMETERS: BEFORE = Keyword string name. ...

Еще в разделе: (Показать все результаты (>45) - sn.sai.msu.ru/ )

. Name . Last modified . Size . Description . about_center/ . 14-Sep-2013 14:31 . - . sections/ . 31-Oct-2007 14:46 . - . Apache/2.2.16 (Debian) Server at educenter.sinp.msu.ru Port 80

Еще в разделе: (Показать все результаты (>9) - educenter.sinp.msu.ru/ )

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>17) - antares.sinp.msu.ru/ )

... Science . ... 15:00 S.A. Akhmanov Hall, Nonlinear Optics Bld. ... Home Science and education Scientific Laboratories Laboratory of nonlinear polarization optics . ... The mechanisms of evolution of polarization during radiation propagation in nonlinear media with nonlocality of optical response. ... As a result, a new field of science has originated, the nonlinear polarization optics, providing new insights into the interplay of polarization effects in classic nonlinear optical processes. ...

Еще в разделе: (Показать все результаты (>30) - ilc.phys.msu.ru/ )

• Grant detail
• Грант подробно

... Ultrastructural changes in the cell center during enterocyte differentiation in the mouse. Tsitologiia. ... Microtubule and intermediate filament patterns around the centrosome in interphase cells. ... The effect of the UV microirradiation of the centrosome on cell behavior. ... A stereoscopic analysis of the centrosome structure in tissue culture cells under the action of carbonyl cyanide p-trifluoromethoxyphenylhydrazone and ouabain Tsitologiia. ... Alieva IB, Vorob'ev IA, Chentsov YuS. ...

Еще в разделе: (Показать все результаты (>34) - cellmotility.genebee.msu.ru/ )

... Publications . ... SPDC Laboratory . Quantum Electronics Chair . ... Error: You currently have Javascript disabled. ... Generation of Arbitrary Frequency-Entangled States of Two-Photon Light?, JETP, 108 (1), 33?42 (2009). ... We consider a new method for the generation of polarization-frequency entangled states of photon pairs. ... Download [ help ]: . ... All persons copying this information are expected to adhere to the terms and constraints invoked by each author's copyright. ...

Еще в разделе: (Показать все результаты (>127) - qi.phys.msu.ru/ )

... Resources . ... Eurasian Center . for Food Security . Home About About Eurasian Center for Food Security . ... Our mission: €аPromote and coordinate collective actions for strengthening food security in Eurasia through research and development. ... The ECFS Mission should be creating conditions for the development and implementation of a coherent agricultural policy that ensures soil fertility, conservation of natural resources and ensuring food security of the Eurasian region. ...

Еще в разделе: (Показать все результаты (>23) - ecfs.msu.ru/ )

• CIMMYT Informa 1855 | ECFS
• Online Consultation on Network and Partnerships in the area of Food Security |
• Topic 1: Building the Eurasian Food Security Network / Создание Евразийской

.

Еще в разделе: (Показать все результаты (>7) - www.msu.dubna.ru/ )

NATO Publishing Unit P.O. Box 17 3300 AA Dordrecht A U T H O R 'S D A T A B A S E E N T R Y S H E E T (to be submitted together with the scientific paper ) REFERENCE: ARW978587 TITLE OF THE NATO MEETING/ NATO ASI SERIES VOLUME : Use of Humic Substances to Remediate Polluted Environments: from Theory to Practice NAME OF THE DIRECTOR: Dr. Norbert ... The total space available for keywords and abstract of your paper is 900 characters (approx. 100 words). ...

Еще в разделе: (Показать все результаты (>96) - mgumus.chem.msu.ru/ )

• MGUMUS -- Third Conference of CIS IHSS on Humic Innovative Technologies Humic
• IHSS-14

... Если в сложно-составных предложениях (т.е. в предложениях, состоящих из нескольких независимых предложений) независимые предложения разделяются сочинительными союзами ( and, but, or, nor, for, yet, so, as (в смысле since, because ), while (в смысле at the same time )), то перед этими союзами ставятся запятые: . ... He could go into debt for the sports car, or he could buy the much cheaper economy car . ... Запятая также может быть опущена, если одно из двух независимых предложений "короткое". ...

Еще в разделе: (Показать все результаты (>32) - num-anal.srcc.msu.ru/ )

• Словарь
• Параллельные программы

... Doronina L. , Volodin I., Volodina E. The arousal-related shifts in call characteristics of the defeated great gerbils Rhombomys opimus // 6th International Zoo and Wildlife Research Conference on Behaviour, Physiology and Genetics, Berlin, IZW, 2007, p. 77. ... Sibling aggression in lynx: traits and consequences // Advances in Ethology 38, Supplements to Ethology. ... Advances in Ethology, Contributions to the 5-th International Symposium on Physiology, Behaviour and Conservation of Wildlife. ...

Еще в разделе: (Показать все результаты (>42) - vertebrata.bio.msu.ru/ )

• Courses
• Выступления студентов и аспирантов на конференциях

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . Application of ferrites in gas sensors . The principal advantage of ferrite as compared to conventional sensor based on semiconductor materials of metal oxides is the ability to adjust their band structure , the nature of the active sites on the surface , changing the cation composition . ... 2008-2014 Laboratory of chemistry and physics of sensor and semiconductor materials. ...

Еще в разделе: (Показать все результаты (>16) - www.lssm.inorg.chem.msu.ru/ )

... О факультете . ... Master In Ecology . ... Master (MSc) . ... A Master will be able to successfully deal with conceptual issues and practical problems related to various subflields of ecology and environmental science. ... Enables the students to develop biopolicies to deal with ecological problems caused by environmental pollution, the disruption of the ecological matrix of an area, and biodiversity-endangering factors. ... Lectures . ... Д 501.001.20 - все защиты . ... Биологический факультет МГУ ...

Еще в разделе: (Показать все результаты (>5) - www.bio.msu.ru/ )

• Master In Nanobiotechnology ? Биологический факультет МГУ