... Cultural Mediation of National History and Identity . ... Second International Conference in Tampere , Finland . ... This sense of national identity, of history and possible futures, is communicated by cultural and institutional forces and integrated, individually and collectively, into our sense of a common shared nationhood. ... Through a semiological analysis of television texts, it is demonstrated how, by a re-interpretation of Russian history, new cultural and national identities are...

Еще в разделе: (Показать все результаты (>70) - psyberlink.flogiston.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>161) - www.pereplet.ru/ )

• "Урания" - Портал "Русский переплет" Soros Education Journal

... Petrakov Director of the Market Problems Institute, Russian Academy of Sciences Secretary: Professor Elena N. Veduta, School of Public Administration , Lomonosov Moscow State University Alexandrov, Dmitry ( Russia , Moscow ) ­ General Theory of Economic Growth and Models of National Economic Development Antonova, Victoria ( Russia , Moscow ) ­ Democratization of Economic Life as the Basis of Sustainable ...

Еще в разделе: (Показать все результаты (>45) - www.spa.msu.ru/ )

• Manuscript guidelines

Security of Quantum Key Distribution Protocol Based on Ququarts Alexander P. SHURUPOV 1 , and Sergei P. KULIK Faculty of Physics, Moscow M.V.Lomonosov State University Abstract. ... In case of D = 4 it was found, that in practice one can relatively easily prepare 12 states based on the polarization states of two-photon field and belonging to three mutually unbiased basis [5,6]. ... This setup allows one to split two orthogonal polarization states of biphoton, namely |H1 and |V2 ones. ...

Еще в разделе: (Показать все результаты (>95) - qi.phys.msu.ru/ )

• http://qi.phys.msu.su/papers/2007-jetp(e)-104-736.pdf
• http://qi.phys.msu.ru/papers/2010-nphoton-4-585.pdf
• http://qi.phys.msu.ru/kulik/Papers/JETP_Shurupov07.pdf

... Finance for Start-Up . ... Инновационная . структура МГУ . ... Обучение инновационному менеджменту . ... деятельности . ... Process of Forming a Company . ... Typical business development & equity scenario . ... Unfortunately, there is no single type of financing appropriate for all start-up companies and no single path to accessing money. ... 2005 Управление инновационной политики . и организации инновационной деятельности . МГУ им. М.В. Ломоносова . ...

Еще в разделе: (Показать все результаты (>38) - innovation.msu.ru/ )

• Process of Forming a Company - Discussion Question

... Форумы > Аспирантура > Тема . ... Аспирантура в Англии по машинному обучению . Если Вас интересует аспирантура в Англии по теме 'Машинное обучение' (с большим весом математических методов: функциональный анализ, теория вероятностей,...), пожалуйста свяжитесь со мной: vovk@cs.rhul.ac.uk (Владимир Вовк). ... Название проекта, в рамках которого ищется аспирант, - 'Practical competitive prediction' (funded by EPSRC). ... Сайт работает с 29.08.2000, Copyright 2000 2011 MMOnline.Ru and MMForce.Net, . ...

Еще в разделе: (Показать все результаты (>362) - www.mmonline.ru/ )

• Математический семинар Глобус, заседание 12 октября 2006 г.
• MMOnline | Форумы | Разное | Требуется Web - дизайнер.
• MMOnline | Форумы | Разное | Программисты

... Only by numerical simulation. ... moment T (K) Dipole moment (D) Experiment Other example: Diffusion constant 200 250 298 350 400 2.40 2.37 2.48 2.59 2.80 2.25 The Distribution functions: radial distribution function 1 g (r) = N t =1 j i N TS N pair ( r - rij ) The Distribution functions: radial distribution function CC def 2 Work mode ­ computer related 1) · Perform simulation , create trajectory file · Calculate properties timestep by timestep 2) · Perform ...

Еще в разделе: (Показать все результаты (>24) - www.elch.chem.msu.ru/ )

• http://www.elch.chem.msu.ru/mole/lecture/qfeldman.pdf
• http://www.elch.chem.msu.ru/mole/lecture/qantipov.pdf

Contents Curricula, and Programs. Mathematical Analysis. (The Program of Mathematical Physics Department).............................................. Algebra and Analytical Geometry.(The program of (General "Mathematics" Department)................................ Computer and Programming. (The program of Algorithmic Languages Department).................................... The practical work on Computers.( Department of Algorithmic. Languages)............................................... Discrete

Еще в разделе: (Показать все результаты (>4) - mph.cmc.msu.ru/ )

... Let the control system be given by the equation dx = X (x, u) = X, u U, dt where X is a vector field on the configuration space M , x M , u is the control parameter, U is the set of admissible values of u. With the vector field X we canonically associate a scalar-valued fiberwise linear function HX on the cotangent bundle T M , HX ( , u) = , X ( , u) , T M , u U, where : T M - M is the canonical pro jection. ...

Еще в разделе: (Показать все результаты (>26) - pont2008.cmc.msu.ru/ )

• http://pont2008.cs.msu.ru/files/en/abstracts/Ray.pdf

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>13) - tukachev.flogiston.ru/ )

• Category: Новости

Optical Transport N etwork (OTN) Tutorial Disclaimer: This is a Tutorial. This is NOT a Recommendation! This tutorial has no standards significance. It is purely for educational purposes. In case of conflict between the material contained in the tutorial and the material of the relevant Recommendation the latter always prevails. This tutorial should NOT be used as a reference; only the relevant Recommendations can be referenced. Summary This document provides a tutorial for Optical Transport Network stand

Еще в разделе: (Показать все результаты (>12) - lvk.cs.msu.su/ )

• http://lvk.cs.msu.su/~bahmurov/course_realtime/papers/balashov_et_al_eucass2011_monitoring.doc

... One can compare the positions of these singularities and their corresponding singular variables in the Feynman diagrams which contribute to the signal process under consideration, and to both reducible and irreducible backgrounds. ... For a standard analysis using cuts on variables, one should cut hard against the regions of singularities in the background singular variables while keeping the regions with singularities for the signal singular variables (see e.g. [8]). ...

Еще в разделе: (Показать все результаты (>8) - top.sinp.msu.ru/ )

• http://top.sinp.msu.ru/lev/cms5.ps

... Opening of the educational programme - School of CEOs, "Capsule of security" for the key managers of Bashneft Group. 2013/04/02 - 4:30pm . ... Higher School of Management and Innovation (Faculty of Lomonosov MSU) was founded in June 2006 by the Academic Council on the initiative of the Moscow State University Rector, academician V.A. Sadovnichiy and Chairman of the Board of Directors of JSFC "Sistema" V.P. Yevtushenko. ... MSU website . ... 2006-2016 MSU Higher School of Management and Innovation. ...

Еще в разделе: (Показать все результаты (>8) - hsmi.msu.ru/ )

• Project and Process Management | MSU Higher school of management and innovation
• Opening of the educational programme - School of CEOs, "Capsule of security"

Space Weather . ... Main page . ... Data . ... Data base . Satellite trajectory viewer . ... Storage and processing of space experiments, in conjunction with the Internet access system, are the main components of the system of space monitoring. ... CORONAS-F . ... The space monitoring data base contains measurements of domestic satellites since 1983. ... Now the data base continues to be filled up in line with the operational satellites connection timetable(Meteor-M ?1, Electro-L ?1). ...

Еще в разделе: (Показать все результаты (>6) - swx.sinp.msu.ru/ )

• SWX - Данные Satellite trajectories
• SWX - Анализ

ISSUE 1 RUSSIA U.S. BILATERAL ON CYBERSECURITY CRITICAL TERMINOLOGY FOUNDATIONS APRIL 2011 The Russia U.S. Bilateral on Cybersecurity ­ Critical Terminology Foundations Issue 1 The principle editors of this document are: Karl Frederick Rauscher, EastWest Institute and Valery Yaschenko, Information Security Institute of Moscow State University. ... INFORMATION AND CYBER .. ... Scientific Adviser to the Director of the Lomonosov Moscow State University Institute of Information Security Issues. ...

Еще в разделе: (Показать все результаты (>23) - iisi.msu.ru/ )

• http://www.iisi.msu.ru/UserFiles/File/bayern2009/crain_pres.pdf
• http://www.iisi.msu.ru/UserFiles/File/bayern2009/twomey.doc
• http://www.iisi.msu.ru/UserFiles/File/bayern2009/global_dns.pdf

... Aleksandrova Luydmila Vasilyevna (Moscow) . ... Tel.: 954-50-98, 403-14-49 . ... Andreeva Marina Victorovna (Moscow) . ... Tel.: 8 916 844 51 11 . ... Anoshkina Zhanna Grigoryevna (Moscow) . ... Tel.: (095) 939-51-15 j2@ffl.msu.ru . ... Infocommunication as a factor influencing the professional socialization of future language teachers . Tel.: 68-06-44 . ... Using multimedia in teaching professional communication to future teachers . ... Дистанционный курс английского языка "Bensons" . ...

Еще в разделе: (Показать все результаты (>21) - anazarenko.ffl.msu.ru/ )

... The detectors used in the setup had efficiency three orders of magnitude better than ones used before. ... As a result, effect of nonlocal influences of several largescale processes related with the weather changes, the geomagnetic variations, the ionospheric and solar activity have reliable been detected. ... йи з ед гв б 7 (2) (3) (4) All known local factors influencing on : temperature, pressure, chemism, illumination, electric field etc. must be excluded or stabilised. ...

Еще в разделе: (Показать все результаты (>19) - temporology.bio.msu.ru/ )

• http://temporology.bio.msu.ru/EREPORTS/krugly_unfaithful.pdf
• http://temporology.bio.msu.ru/EREPORTS/krugly_discrete-sequential.pdf
• http://temporology.bio.msu.ru/EREPORTS/krugly_an-example.pdf

... Next Routine] [List of Routines] NAME: ADD_HEADER PURPOSE: addition information from FITS-headers MPFS-frames DESCRIPTION: The function computes the total exposure, mean value zenit distance and modified FITS header CALLING SEQUENCE: Result =ADD_HEADER( headers ) CATEGORY: reduction MPFS-data INPUTS: Headers = String array FITS-headers from the MPFS data OUTPUTS: Header = String array containing the header from the FITS file. ... OPTIONAL INPUT KEYWORD PARAMETERS: BEFORE = Keyword string name. ...

Еще в разделе: (Показать все результаты (>45) - sn.sai.msu.ru/ )

... Seminars . ... Group 417 [ PDF ] Students are expected to attend lectures and seminars which is the standard forum for class communication. ... Some of the homework problems might appear on the tests and the exam. ... Your class grade total percentage is given by 40% seminar and homework, 25% first test and 35% second test. ... Students with the class grade 5 and 4 may get a final course grade without a final exam, but only upon the recommendation of seminar assistants. ... Test 1 [ PDF ] . ...

Еще в разделе: (Показать все результаты (>31) - nanofluidics.phys.msu.ru/ )