... CM4all Offers Web Hosts WebDrive . ... emulates the Windows Explorer through a browser based interface. basically the approach of having your windows explorer in the Web browser, he says, having all your files in some professional managed data center and professional storage system, which gives you ... of an existing CM4all installation or independently for companies already using other tools or ISPs not interested in offering Web hosting ... michael kors outlet uk . ... 2016 С Днем Победы! ...

Еще в разделе: (Показать все результаты (>101) - elana.sinp.msu.ru/ )

• cheap ralph lauren Fellowship of Christian Athletes Scholarships | С Днем
• cheap moncler uk 4 16v loss of oil pressure at 2000rpm | С Днем Победы!
• becoming one in the first women since you may have heard of stars like Trish

... Payment is made at transfer of means for the University account All expenses of transferring the money to the University account are beard by the Student. In the event the Student is expelled by the University for the lack of academic progress; transgression of the sections stated in Article 3; for the Student's own personal reasons; for medical reasons confirmed by the official medical paper, all payments made are non-refundable. Article 2 Obligation and rights of the University 2.1. ...

Еще в разделе: (Показать все результаты (>32) - foroff.phys.msu.ru/ )

• http://foroff.phys.msu.ru/phys/med/engl_ver/evc_06ep.pdf
• http://foroff.phys.msu.ru/illposed/programs/Fig4_6.txt
• Postdoctoral training (Neutronography)

... In a sphere-plane geometry, routinely used in atomic force microscope and surface force apparatus, it can form a bridge connecting the surfaces. ... By minimizing the free energy of a binary mixture we obtain the force-distance curves as well as the structural phase diagram of the configuration with the bridge. Numerical results predict a discontinuous transition between the states with and without the bridge and linear force-distance curves with hysteresis. ... Phys., Vol. ...

Еще в разделе: (Показать все результаты (>29) - nanofluidics.phys.msu.ru/ )

• http://nanofluidics.phys.msu.ru/paper/jcis3.pdf
• http://nanofluidics.phys.msu.ru/paper/jfm2008.pdf
• http://nanofluidics.phys.msu.ru/paper/pre2006e.pdf

Program XXXVI International Conference of the Russian Society for American Culture Studies Nature and Sustainability of Culture Moscow, December 3-10, 2010 Section 1. ... Nature in the nineteen-century American culture (The concept of Nature and its evolution from Romanticism to Naturalism. ... O.Y. Danchevskaya Moscow State Pedagogical University, Moscow, Russia Concept of Soul among North American Indians Soul is probably the most vital notion in any religion, though ideas about it vary greatly. ...

Еще в разделе: (Показать все результаты (>35) - www.journ.msu.ru/ )

• The students of the Faculty of Journalism visited the Saxion University ::
• The Second International Media Readings in Moscow :: Факультет журналистики МГУ
• The Second International Media Readings in Moscow

Mathematical Finance, Vol. ... September 1920 1922-1925 1925-1927 January 1926 1 October 1927 1937 1 October 1937 1941 28 April 1946 1996 Louis Jean-Baptiste Alphonse Bachelier is born in Le Havre Graduates from secondary school at Caen Father's death Mother's death Bachelier is the head of Bachelier fils Military service Student at Sorbonne Bachelor in sciences at Sorbonne Certificate in mathematical physics Bachelier defends his ... BACHELIER'S PUBLISHED WORKS Books 1. ...

Еще в разделе: (Показать все результаты (>38) - new.math.msu.su/ )

• http://new.math.msu.su/Sites/demosite/Uploads/abstractsm50.58D32DCEDD634CB0AA8244EDE617F1DB.pdf
• http://new.math.msu.su/department/hydro/papers/2012-jfs.pdf

ORF ALEA CENTER FOR GL OB AL INTERNA TIONAL S TUDIES UNIVERSIT Y OF C ALIFORNIA, SANT A BARBAR A THE ROLE OF RELIGION IN GLOBAL CIVIL SOCIETY: THE MOSCOW WORKSHOP Lomonosov Moscow State University Moscow , Russia June 19, 2013 Sponsored by the Henry R. Luce Initiative on Religion and International Affairs Luce Moscow Workshop The Moscow workshop for the Or falea Center 's Luce Project on religion in ... Moscow State University has its own church of the Saint Tatiana. ...

Еще в разделе: (Показать все результаты (>57) - fgp.msu.ru/ )

• http://www.msu.ru/en/admissions/general-programs/docs/FACULTY%20OF%20GLOBAL%20STUDIES.pdf

... This is a bug fix release for the 3.x series of Joomla. ... Project and the Production Leadership Team are proud to announce the release of Joomla! 3.5 as the latest in the 3.x series. ... CMS 3.5 Release Candidate 4 . ... CMS, with 3.5 the sixth standard-term support release in this series. ... That being said, please do not upgrade any of your production sites to the release candidate version as a release candidate is ONLY intended for testing and there is no upgrade path from a Release Candidate....

Еще в разделе: (Показать все результаты (>3) - biophys.phys.msu.ru/ )

Intel® Fortran Compiler Options Quick Reference Guide for Linux* Systems Legal Information Copyright © 2003 Intel Corporation Document Number: 253258-001 i Intel® Fortran Compiler Options Quick Reference Disclaimer and Legal Information Information in this document is provided in connection with Intel products. No license, express or implied, by estoppel or otherwise, to any intellectual property rights is granted by this document. EXCEPT AS PROVIDED IN INTEL'S TERMS AND CONDITIONS OF SALE FOR SUCH

Еще в разделе: (Показать все результаты (>31) - www.arcetri.astro.it/ )

• http://www.parallel.ru/sites/default/files/ftp/cluster/intel-8.0/for_ug1.pdf
• http://www.parallel.ru/sites/default/files/ftp/cluster/intel-8.0/for_ug2.pdf
• APOD: 2000 May 7 - A Green Flash from the Sun

... E.V. Kazarovets, N.N . Samus , O.V. Durlevich, S.V. Antipin, M.S. Frolov, N.N . Kireeva, E.N. Pastukhova Institute of Astronomy of Russian Academy of Sciences and Sternberg State Astronomical Institute of ... the Moscow State University ================================================================================ The 74th Special Name-list of Variable Stars , A.V. Kazarovets, N.N . Samus , O.V. Durlevich, S.V. Antipin, M.S.,Frolov, ... 3323 Samus, N.N., IBVS, 1997, No. ...

Еще в разделе: (Показать все результаты (>28) - www.sai.msu.ru/ )

• Index of /groups/cluster/gcvs/digit
• Moscow Astronomical Plate Archives: Contents, Digitization, Current and

... It is shown that theoretical methods developed for description of hopping transport in disordered inorganic solids, such as amorphous semiconductors, can also be successfully applied to description of hopping transport in organic disordered systems, such as conjugated or molecularly doped polymers. We concentrate our discussion on percolation approach and show its universal applicability to systems with different distributions of localized state energies. ...

Еще в разделе: (Показать все результаты (>66) - scon155.phys.msu.su/ )

• Generalized pair approximation in the description of ate AC conductivity of a
• Oleg G. Koshelev

... Let the control system be given by the equation dx = X (x, u) = X, u U, dt where X is a vector field on the configuration space M , x M , u is the control parameter, U is the set of admissible values of u. With the vector field X we canonically associate a scalar-valued fiberwise linear function HX on the cotangent bundle T M , HX ( , u) = , X ( , u) , T M , u U, where : T M - M is the canonical pro jection. ...

Еще в разделе: (Показать все результаты (>15) - pont2008.cmc.msu.ru/ )

• http://pont2008.cs.msu.ru/files/en/abstracts/Agrachev.pdf
• On mathematical creative work of L.S. Pontryagin (By D.V. Anosov) International

... Mathematical models and methods in VLSI design . ... General models and statements about the complexity of combinatorial tasks, methods for development of fast algorithms (method of dynamic programming, ?divide and conquer?, ?method of model extension?) are considered. ... Mathematical models of contemporary electronic circuits are considered and basic approaches to solving task of logic synthesis, as well as tasks of VLSI modules placement and interconnection routing are described. ...

Еще в разделе: (Показать все результаты (>9) - hcs.cmc.msu.ru/ )

• Master program "Enterprise Information Systems" | Магистерское и послевузовское
• Master programљ"Decision Engineering in Economics and Finance" | Магистерское и

... Cultural Mediation of National History and Identity . ... Second International Conference in Tampere , Finland . ... This sense of national identity, of history and possible futures, is communicated by cultural and institutional forces and integrated, individually and collectively, into our sense of a common shared nationhood. ... Through a semiological analysis of television texts, it is demonstrated how, by a re-interpretation of Russian history, new cultural and national identities are...

Еще в разделе: (Показать все результаты (>9) - psyberlink.flogiston.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/jbcb_2006.pdf

... Natalia Kireeva graduated from the department of biochemistry and worked in different laboratories in Moscow and the USA. ... Maria Sudnitsyna graduated from Moscow State University in 2004, and during the next two years, she investigated the mechanisms of the function of mitochondrial Complex I. Then, she continued her work in a biotechnological firm, and in 2008, she returned to Moscow State University and started her work at the Department of Biochemistry in the group of Prof. N.B. Gusev. ...

Еще в разделе: (Показать все результаты (>32) - biochem.bio.msu.ru/ )

• Emerging evidence for a similar role of glutamate receptors in the nervous and
• Biochemistry Department of Moscow State University | Na,K-ATPase and its role
• The excitotoxic effect of NMDA on human lymphocyte immune function.

... A comparative study of thermodynamic for both natural and artificial RNA/DNA ­ protein complexes would establish bases for a specificity of complex formation. In particular, we have shown that aptamers could be used for a direct measuring of thrombin enzymatic activity in a solution. D 2002 Published by Elsevier Science B.V. Keywords: RNA/DNA ­ protein interactions; Ribosome; SELEX; RNA/DNA aptamers; Thrombin; Enzymatic activity 1. ... The aptamer binds to the protein with Kd = 0.5 nM. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/febsz.pdf
• http://rnp-group.genebee.msu.su/pdfs/MolBio6_00KopylovLO.pdf

Форум МГУ Главная Помощь > . ... BB-коды . ... Делает выделенный текст полужирным, наклонным, подчеркнутым или зачеркнутым. Пример: . Это [B]полужирный[/B] текст. ... Вывод: . ... Изменяет цвет, шриф или размер выделенного текста. ... Создать ссылку из выделенного текста. ... URL]http://www.example.com[/URL] . ... Делает выделенный текст ссылкой на интернет-страницу или адрес e-mail. ... Показывает картинку, используя выделенный текст как URL . ... Увеличивает отступ выделенного текста. ...

Еще в разделе: (Показать все результаты (>24) - osk.msu.ru/ )

html head title Перемещение слоя в режиме drag /title script language= javaScript !-- var app; var szx = 0 ; var szy = 0 ; function start_drag () { app = document.applets.red; app.open_change_mode(0); rc = app.set_current_layer(' show '); if( rc==-1 ) {alert( Нет указанного слоя show ); return ;} app.set_ drag _layer( show ); drag (); ...

Еще в разделе: (Показать все результаты (>20) - adept.srcc.msu.ru/ )

• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/drag/drag2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch1text1.htm

153­161 Contents lists available at ScienceDirect Electrochimica Acta jo u r n al hom ep age: www.elsevier.com/locate/electacta Charge transfer processes on electrodes modified by polymer films of metal complexes with Schiff bases O.V. Levin a , M.P. Karushev b , A.M. Timonov b , E.V. Alekseeva a , Shuanghua Zhang V.V. Malev a,d,,1 a b c d ... Fig. ... Low frequency capacities of polymer films. (a) Poly-[Ni(CH3 O-SalPhen)] film. (b) Poly-[Ni(CH3 O-SaltmEn)] film. ...

Еще в разделе: (Показать все результаты (>71) - electr003.chem.msu.ru/ )

• Frumkin Institute, Theoretical Department

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>19) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/seminar/Kulikovskiy.pdf
• http://antares.sinp.msu.ru/docs/INFN%20-%20ANTARES.pdf
• http://antares.sinp.msu.ru/docs/INFN%20-%20NEMO.pdf