1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/jbcb_2006.pdf

153ґ161 Contents lists available at ScienceDirect Electrochimica Acta jo u r n al hom ep age: www.elsevier.com/locate/electacta Charge transfer processes on electrodes modified by polymer films of metal complexes with Schiff bases O.V. Levin a , M.P. Karushev b , A.M. Timonov b , E.V. Alekseeva a , Shuanghua Zhang V.V. Malev a,d,,1 a b c d ... Fig. ... Low frequency capacities of polymer films. (a) Poly-[Ni(CH3 O-SalPhen)] film. (b) Poly-[Ni(CH3 O-SaltmEn)] film. ...

Еще в разделе: (Показать все результаты (>69) - electr003.chem.msu.ru/ )

• http://www.elch.chem.msu.ru/rus/chteniya/f30_vorotyntsev.pdf
• Frumkin Institute, Theoretical Department
• Laboratory of Electrochemical energetics

... Emerging evidence for a similar role of glutamate receptors in the nervous and immune systems. ... The role of glutamate receptors in synaptic transmission and excitotoxicity in the nervous system is well established. ... We conclude that glutamate is involved in signaling in immunocompetent cells and that the expression of both ionotropic and metabotropic glutamate receptors may have regulatory functions in immunocompetent cells, as well as in the nervous system. ...

Еще в разделе: (Показать все результаты (>61) - biochem.bio.msu.ru/ )

• Chaperone-like activity of monomeric human 14-3-3zeta on different protein
• Biochemistry Department of Moscow State University | The physiological role of
• Generation of recombinant antibodies and means for increasing their affinity.

Moscow Astronomical Plate Archives: . Contents, Digitization, Current and Possible Applications . ... We describe the astronomical plate archives in Moscow and Zvenigorod and the existing digitization projects. ... 2 The Plate Archive of the Sternberg Institute . The contents of the most important Moscow astronomical plate archive, that of the Sternberg Astronomical Institute, was briefly presented in Shugarov et al. [1] in 1999. ... THE MOSCOW PLATE COLLECTION (STERNBERG INSTITUTE) . ...

Еще в разделе: (Показать все результаты (>23) - www.sai.msu.ru/ )

• Отдел внегалактической астрономии: ГАИШ Extra-galactic astronomy Group Student

... TUS . ... News . ... TUS Ultra high energy cosmic ray detector on-board the Lomonosov satellite . ... Modi?ed KLYPVE is a novel ?uorescence detector of ultra high energy cosmic rays (UHECRs, energies 50EeV) to be installed on the Russian Segment of the International Space Station. ... Two types of orbital detectors of extreme energy cosmic rays are being developed nowadays: (i) TUS and KLYPVE with reflecting optical systems (mirrors) and (ii) JEM-EUSO with high- transmittance Fresnel lenses. ...

Еще в разделе: (Показать все результаты (>13) - uhecr.sinp.msu.ru/ )

• UHECR news
• Новости КЛПВЭ

NMW survey overview . Access image archive . ... The New Milky Way survey aims to detect bright (V<13.5) optical transients near the Galactic plane using an automated wide-field (8x6 deg.) system capable of surveying the whole Milky Way area visible from the observing site in one night. ... All images obtained during the transient search survey are available online (please use the image archive access form ). ... Images per field: . ... Images per night: . ... Milky Way imaging time: . ...

Еще в разделе: (Показать все результаты (>4) - scan.sai.msu.ru/ )

• Index of /lk/source

EUROPEAN COMMISSION Education and Culture Lifelong Learning: Education and Training policies Vocational training and adult education FUNDAMENTALS OF A `COMMON QUALITY ASSURANCE FRAMEWORK' (CQAF) FOR VET IN EUROPE (updated version of 29/09/05) Contact person: Fernanda Oliveira Reis, DG Education and Culture ( fernanda.oliveira-reis@cec.eu.int ) 1 TABLE OF CONTENTS 1. ... The second rationale was to link quality management activities to policy objectives agreed at European level for the VET systems. ...

Еще в разделе: (Показать все результаты (>52) - www.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/eng/archive/2015/2/08.pdf
• English version - Социологический факультет МГУ

... Another situation is that of effective slip, beff , which refers to a situation where slippage at a complex heterogeneous surface is evaluated by averaging of a flow over the length scale of the experimental configuration (e.g. a channel etc) [3, 14ґ16]. ... Rough surfaces 4. ... We seek the solution for a velocity u by perturbation analysis: u = u0 + u1 , (6) where u0 is the velocity of the Poiseuille flow, and the effective slip length beff at the super-hydrophobic surface is defined as b Figure 6...

Еще в разделе: (Показать все результаты (>36) - nanofluidics.phys.msu.ru/ )

• http://nanofluidics.phys.msu.ru/paper/jcp20042.pdf
• http://nanofluidics.phys.msu.ru/paper/pre2012_1.pdf
• http://nanofluidics.phys.msu.ru/paper/pre2006e.pdf

Cooperation with Third Country participants Cooperation with Third Country Participants in an EC funded FP7 multi-partner research project1 - Practical Advice for Proposal Submission and Negotiation ґ What are Third Country Participants in this context? ... For a complete list of associated countries see ftp://ftp.cordis.europa.eu/pub/fp7/docs/third_country_agreements_en.pdf. ... 2 Cooperation with Third Country participants account by the coordinator already at the proposal stage. ...

Еще в разделе: (Показать все результаты (>32) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/ERC_rules.pdf
• http://ideas.msu.ru/docs/fp7_rules.pdf
• http://ideas.msu.ru/docs/ERC_guide_preparation.pdf

ISSN 1060 992X, Optical Memory and Neural Networks (Information Optics), 2013, Vol. ... The used architectures of ANN allow detecting fluorescence of carbon dots against the background of proper fluorescence of egg protein with reasonably high accu racyґnot worse than 0.002 mg/mL. ... This methodology includes elaboration of procedure of data preparation, determination of optimal neural network architectures, algorithms and parameters of their training. ... This is unfavorable for ANN training. ...

Еще в разделе: (Показать все результаты (>24) - rswater.phys.msu.ru/ )

• http://rswater.phys.msu.ru/en/articles/2014/JBO_19_11_117007.pdf
• http://rswater.phys.msu.ru/en/articles/2014/Using.pdf
• http://rswater.phys.msu.ru/en/articles/2014/Nanosystems_CD_ANN_2014.pdf

... We present some results of new calculations of D" ( t ) the second derivative of the Moon's elongation as a function of time. ... Let X be a set of all preserved recordings of observations of ancient Sun and Moon eclipses (see the list in [ 2 ], pp. 167 271): let A be a set of eclipses described in X (any eclipse a A may have some records corresponding to it and form X ( a )). ... The recount of dates t ( a 0 ), a 0 A ,( 700) < t ( a 0 ) < (+400), was first made by N. A. Morosov. ...

Еще в разделе: (Показать все результаты (>96) - hbar.phys.msu.ru/ )

• R. R. Newton, "Two uses of ancient astronomy"
• Critical remarks

... School problem is extremely important. ... Our President has mentioned the territorial disparity, i.e. two-thirds of our schools are the rural schools and their graduates are at unequal terms with their equals from cities' schools to get following education. ... Create special conditions in education for disabled children, for orphans and children from unfortunate families, pupils from rural schools and gifted children. ... Ensure social equity for all children during school education and after it. ...

Еще в разделе: (Показать все результаты (>38) - www.rsr-online.ru/ )

• http://www.rsr-online.ru/doc/norm/327.doc
• http://www.rsr-online.ru/doc/norm/273.doc
• http://www.rsr-online.ru/doc/norm/526.doc

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

... Geography of World Economy . ... Recreational Geography and International Tourism . ... Departments . ... Field training . ... The department curriculum is focused on preparation of experts of the top skills in the field of tourist business, tourist service, the government in tourism sphere. ... A theme of scientific work of department Territorial touristic-recreational systems: natural and social and economic preconditions of a sustainable development includes three underthemes. ...

Еще в разделе: (Показать все результаты (>44) - eng.geogr.msu.ru/ )

• Department of Cryolithology and Glaciology
• Department of Land Hydrology

... Master . ... SAI MSU . Conference was supported by PLC "MO "OPTIKA" . ... Morning session . Chair Hugo Levato (ICATE, Argentina) . ... Vladimir Lipunov ( MSU , SAI ) . ... Evgeniy Gorbovskoy (MSU, SAI) & . А lexander Belinskiy (MSU, SAI) . ... Chair Claudio Mallamaci (OAFA, Argentina) . ... Using MASTER Net in the MSU educational process . ... Chair Victor Kornilov (MSU, SAI) . ... Nikolay Budnev (ISU ) . ... Excursion to the Moscow Kremlin . ... Joint MASTER and Russian Pereplet session. ...

Еще в разделе: (Показать все результаты (>20) - master.sai.msu.ru/ )

• International Workshop ?Robotic observatories?

... Suppose also that g is continuously differentiable in (0, 1) and g (x) 1 if x (0, 1). Prove that there exists a point t [0, 1] such that f (t) = g (t) = t. 2. ... vn ) the k в n-matrix formed by the coordinates of v1 , . ... Prove that one I can make the matrix A upper-triangular with zeroes at the principal diagonal by finitely many transformations of the following type: one transposes any two lines in the matrix and then transposes the columns with the same numbers. ... Let S AB C be a pyramid. ...

Еще в разделе: (Показать все результаты (>37) - dfgm.math.msu.su/ )

• http://dfgm.math.msu.su/files/papers-sym/remark%20on%20nonsymmetric%20compact%20surfaces.pdf
• http://dfgm.math.msu.su/files/papers-sym/brahana.pdf
• http://dfgm.math.msu.su/files/papers-sym/reg%20maps%20nonorientable%20surfaces.pdf

... Форумы > Разное > Тема . Автор темы . Форумы Список тем Новая тема . ... Что такое &quot;moment map&quot; в контексте . Что такое moment map в таком контексте: . the existance of torus actions follows from the existance of 1-cycles on the "Milnor fiber" of the _moment_map_ which are invariant under the "monodromy". Ответить Цитировать . ... Следующая тема Предыдущая тема . ... Сайт работает с 29.08.2000, Copyright 2000 2011 MMOnline.Ru and MMForce.Net, . ...

Еще в разделе: (Показать все результаты (>145) - www.mmonline.ru/ )

• MMOnline | Форумы | Аспирантура | Аспирантура в США
• MMOnline | Форумы | Аспирантура | Internship, PhD program, and PhD exchange
• MMOnline | Форумы | Аспирантура | Армия vs Ph.D program