The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>51) - geophys.geol.msu.ru/ )

. This diagram illustrates how content may be clipped. One box, with a red border, is shown. In the lower right hand quadrant of this (DIV) box, part of the text contents of the BLOCKQUOTE element, with a dashed top and left border, are shown. The rest of the text is not visible since it is clipped by the DIV box, whose 'overflow' property has the value 'hidden'. Return to image.

Еще в разделе: (Показать все результаты (>961) - crydee.sai.msu.ru/ )

• Dynamic HTML in Communicator
• Long description for example with unclipped overflow
• Visual effects

... Grand spiral galaxy NGC 1232 , captured in detail by one of the new Very Large Telescopes , is a good example. ... Invisible are even greater amounts of matter in a form we don't yet know - pervasive dark matter needed to explain the motions of the visible in the outer galaxy. ... August . ... NASA Web Site Statements, Warnings, and Disclaimers . ... Publications with keywords: spiral galaxy - NGC 1232 - dark matter . Publications with words: spiral galaxy - NGC 1232 - dark matter . ...

Еще в разделе: (Показать все результаты (>11631) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• Астронет > Grand Spiral Galaxy NGC 1232
• Астронет > Spiral Galaxy NGC 1232

... 2008 August 24 . Grand Spiral Galaxy NGC 1232 . ... Explanation: Galaxies are fascinating not only for what is visible, but for what is invisible. Grand spiral galaxy NGC 1232 , captured in detail by one of the new Very Large Telescopes , is a good example. The visible is dominated by millions of bright stars and dark dust , caught up in a gravitational swirl of spiral arms revolving about the center. ... Tomorrow's picture: NGC 7008 . ... About APOD | ...

Еще в разделе: (Показать все результаты (>3520) - www.sai.msu.su/ )

• APOD: 2001 May 22 - Spiral Galaxy NGC 1232
• APOD: September 30, 1998 - Spiral Galaxy NGC 1232
• APOD: 2012 January 7 - Grand Spiral Galaxy NGC 1232

... CATALINA _TMPDIR= /@GENTOO_PORTAGE_EPREFIX@var/tmp/@INSTANCE_NAME@ # TOMCAT STARTUP # debug Start Catalina in a debugger # - security debug Debug Catalina with a security manager # jpda start Start Catalina under JPDA debugger # start Start Catalina in a separate window # - security start Start in a separate window with JPDA_ADDRESS="8000" #JPDA_TRANSPORT="dt_socket" # Additional options to pass to catalina # #CATALINA_OPTS="" ...

Еще в разделе: (Показать все результаты (>18053) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/sys-apps/mawk/mawk-1.3.4_p20141206.ebuild

TipsOfTheDay . Aggregated List of All Tips, from Main and System. ... Add A New Tip . ... This topic generates the random tip to display. ... Template for new Tips . Tip of the Day . ... To hide sections of a Foswiki topic, use HTML comments. ... This topic: System > Contribs > TipsContrib > TipsOfTheDay > TipsOfTheDayAdmin . ... Copyright by the contributing authors. All material on this site is the property of the contributing authors. Ideas, requests, problems regarding Foswiki? ...

Еще в разделе: (Показать все результаты (>6821) - wiki.cmc.msu.ru/ )

• VarTABLE < System < Foswiki
• TipTopic019 < System < Foswiki

This plugin renders a clickable red dot ( . ... You might also specify a list of topics (see syntax), where the first topic that grants write access will be the target when you click on the red dot. After finishing an edit initiated by a red dot you will be redirected to the topic where the red dot was on, or any other topic that you specify. ... Furthermore, the RedDotPlugin respects the WHITEBOARD topic variable. ... lib/TWiki/Plugins/RedDotPlugin.pm . ... TWiki:Plugins/RedDotPlugin . ...

Еще в разделе: (Показать все результаты (>39869) - dualopt1.cmm.msu.ru/ )

• RedDotPlugin - TWiki - TWiki
• %TOPICTITLE% ( vs. 1) - TWiki
• TWikiTip019 - TWiki - TWiki

This example program looks like a complete modern application. ... ApplicationWindow :: ApplicationWindow () : QMainWindow ( 0, example application main window ) { printer = new QPrinter ; printer- setMinMax( 1, 10 ); QPixmap openIcon, saveIcon, printIcon; fileTools = new QToolBar ( this, file operations ); openIcon = QPixmap( fileopen ); QToolButton * fileOpen = new QToolButton ( openIcon, Open File , 0, this, SLOT ( load ()), fileTools, open ...

Еще в разделе: (Показать все результаты (>560) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - aclock/aclock.cpp example file
• Apache module mod_example
• Qt Toolkit - trivial/trivial.cpp example file

... Client/Server Examples . ... Up: Client/Server Examples Next: Ocean/Atmosphere - Relies on Name Publishing Previous: Client/Server Examples . The following example shows the simplest way to use the client/server interface. ... Up: Client/Server Examples Next: Simple Client-Server Example. ... MPI_Open_port(MPI_INFO_NULL, port_name); MPI_Publish_name("ocean", MPI_INFO_NULL, port_name); . ... MPI_Comm_connect( port_name, MPI_INFO_NULL, 0, MPI_COMM_WORLD, &server ); . ... Центры . ...

Еще в разделе: (Показать все результаты (>372) - www.parallel.ru/ )

• Examples | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Spawn Example | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Library Example #2 | PARALLEL.RU - Информационно-аналитический центр по

Электронная библиотека Попечительского совета . ... Dobbert T. - Matchmoving: The Invisible Art of Camera Tracking . ... Название: Matchmoving: The Invisible Art of Camera Tracking . Автор: Dobbert T. Аннотация: . Matchmoving is the art and science of ensuring that computer-generated objects (i.e., buildings or monsters) look real when put into live-action footage. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>7016) - lib.mexmat.ru/ )

• Aydinonat N.E. - The Invisible Hand in Economics: How Economists Explain
• Журнал Probability and Statistics by Example :: Электронная библиотека
• Pap E. - Complex Analysis Through Examples And Exercises :: Электронная

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > И?Ет . ... example_module . ... РЬ Й?М-ДТ ОЦЦФФЕ Р?М-Й? 2.0 Й?Р?ПЕМ- К?АцЕШ ГЛПыРЛ ДуАэ РжС? ... ОЦЦФФЕ ЙшЦ?КЛ src/modules/example Е?ЗКХфИ? ... И?ЕтРЛ РлМКЧЯЗСДТ ЛчЖ?ЕщРЛ ЕНБтР?Чб ПЙС?Дй. mod_example.c ДТ И?Еч ФнЙщ(callback) БИСЖПЭ Ш?Ут Й?ЙРЛ МГИэЧЯДТ ЦФРЯРЬДй. ... Example . ... mod_example И?Ет ЛчПыЧЯБт . ... src/Configuration ЦФРЯ ОЦЗЕ КЮКаПЕ РжДТ "AddModule modules/example/mod_example" СйРЧ СжМ?УГИ?И? О?ОиДй. ...

Еще в разделе: (Показать все результаты (>423) - itpm.msu.su/ )

• Another Example
• Examples
• An Example sendmail.m4 File

This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>91) - neptun.sai.msu.ru/ )

• Apache module mod_vhost_alias
• Apache's Handler Use
• Mapping URLs to Filesystem Locations - Apache HTTP Server

... Create a new topic that will contain your new CSS files . Attach 3 new style sheets to the topic . Point the CSS preference settings in System.DefaultPreferences or Main.SitePreferences to your new files: * Set FOSWIKI_LAYOUT_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/layout.css * Set FOSWIKI_STYLE_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/style.css * Set FOSWIKI_COLORS_URL = %PUBURLPATH%/%SYSTEMWEB%/YourNewTopic/colors.css . ... The rest of this topic shows examples of small CSS changes. ...

Еще в разделе: (Показать все результаты (>2143) - wiki.cs.msu.ru/ )

• YahooUserInterfaceContrib < System < Foswiki
• IncludeTopicsAndWebPages < System < Foswiki

Modules | ... Apache HTTP Server Version 2.0 . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... If you link it into your server, enable the "example-handler" handler for a location, and then browse to that location, you will see a display of some of the tracing the example module did as the various callbacks were made. ... Using the mod_example Module . ...

Еще в разделе: (Показать все результаты (>758) - uneex.lorien.cs.msu.su/ )

• LecturesCMC/PythonIntro2014/06_FilesModulesSystem/Examples - UNИX
• Building Packages: A Simple Example
• Our Example Spec File: Subpackages Galore!

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>4) - storage.bioinf.fbb.msu.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

To print commands and their arguments as they are executed: cat example #!/bin/sh TEST1=result1 TEST2=result2 if [ $TEST1 = "result2" ] then echo $TEST1 fi if [ $TEST1 = "result1" ] then echo $TEST1 fi if [ $test3 = "whosit" ] then echo fail here cos it's wrong fi . This is a script called example which has an error in it; the variable $test3 is not set so the 3rd and last test [ command will fail. Running the script produces: example result1 [: argument expected . ...

Еще в разделе: (Показать все результаты (>471) - comet.sai.msu.ru/ )

• Example of how mail is displayed
• Examples of using the diff command
• Examples of using the sort command

PHP Manual . ... PHP 3 <= 3.0.18, PHP 4 >= 4.0.0) setcookie -- Send a cookie . int setcookie ( string name [, string value [, int expire [, string path [, string domain [, int secure]]]]]) . ... If only the name argument is present, the cookie by that name will be deleted from the remote client. ... setcookie ("TestCookie", "Test Value"); setcookie ("TestCookie", $value,time()+3600); /* expire in 1 hour */ setcookie ("TestCookie", $value,time()+3600, "/~rasmus/", ".utoronto.ca", 1); . ...

Еще в разделе: (Показать все результаты (>810) - oit.cmc.msu.ru/ )

• ncurses_getmouse
• printer_create_pen
• Bzip2 Compression Functions

We have prepared some summation programs for working with Reduce output. ... 1 in $COMPHEP/test/sum.red $ % loading the summation package in symb1.red $ % reading contributions of diagrams sum; % writing the answer (32*ee**4*(2* p1.p2 **4-4* p1.p2 **3* p1.p3 +3* p1.p2 **2* p1.p3 **2-2* p1.p2 **2* p1.p3 *me**2-p1.p2* p1.p3 **3 + 2* p1.p2 * p1.p3 **2*me**2 + p1.p3 **2*me**4)) /(propden(-p1-p2,me,0)**2*propden(p2-p3,me,0)**2)$ %2 in $COMPHEP/test/sum2pole.red $ % loading the ...

Еще в разделе: (Показать все результаты (>760) - theory.sinp.msu.ru/ )

• fc3:dokuwiki:example [THEP]
• Examples

... Approach to elaboration of elements spectrophotometric determination using microwave radiation . Abstract Approach to determination of elements by spectrophotometric procedure using microwave irradiation is suggested by the example of ruthenium determination with organic reagents. ... Moscow University Chemistry Bulletin . 2006, Vol. ... 4, P. 257 . Copyright (C) Chemistry Dept., Moscow State University, 2002 . ... Copyright (C) Chemisty Department of Moscow State University . ...

Еще в разделе: (Показать все результаты (>168) - chem.msu.ru/ )

• Preparation and the visible light induced interconvertion of rac- and meso-
• Client-side Clickable Image Example
• Entrance Examinations - Preliminary Round