... The Great Nebula in Carina . ... Eta Carinae , the most energetic star in the nebula, was one of the brightest stars in the sky in the 1830s, but then faded dramatically. Eta Carinae is the brightest star near the image center, just left of the Keyhole Nebula . While Eta Carinae itself maybe on the verge of a supernova explosion, X-ray images indicate that much of the Great Carina Nebula has been a veritable supernova factory . Tomorrow's picture: open space . ...

Еще в разделе: (Показать все результаты (>10250) - www.sai.msu.su/ )

• APOD: August 21, 1997 - A Universe in a Box
• APOD: 2011 June 29 - Abell 2744: Pandora's Cluster of Galaxies
• APOD: 2002 June 20 - Bright Galaxy M81

... Астронет | Картинка дня | ... планета Астронет | ... Астрономическая картинка дня . ... Около равноденствия магнитное поле Земли ориентировано так, что создаются благоприятные условия для взаимодействия с солнечным ветром, которое и вызывает прекрасное северное сияние. ... Полярные сияния и магнитосфера Юпитера . ... Слегка сжатое магнитное поле словно через воронку несет заряженные частицы к полюсам Юпитера, опуская их прямо в его атмосферу. ... Туманность Пузырь крупным планом . ...

Еще в разделе: (Показать все результаты (>75679) - www.astronet.ru/ )

• Abell 2744: Pandoras Cluster of Galaxies
• An Orion of a Different Color
• XWare > APOD

This example shows how to make, store to file, and read a picture as a set of drawing commands. ... This example ** program may be used, distributed and modified without limitation. ** *****************************************************************************/ # include ctype.h # include qapplication.h # include qpainter.h # include qpicture.h # include qpixmap.h # include qwidget.h # include qmessagebox.h # include qfile.h void paintCar( QPainter *p ) // ...

Еще в разделе: (Показать все результаты (>750) - rtm-cs.sinp.msu.ru/ )

• Objects in distributed systems

... Laboratory has collection of the bird acoustic signals tape-recordings (more than of 150 species). ... The laboratory collection of hamsters includes 16 species (out of 19 distributed in the Palearctic). ... Thus, we have got an opportunity to conduct comparative analysis of behavior, chemical communication both in phylogenetically close and distant species. ... A comparative study of both optical and acoustic communicative signals in all six swan species of the world fauna has been accomplished. ...

Еще в разделе: (Показать все результаты (>6176) - www.sevin.ru/ )

• Laboratories: Laboratory for Ecology of Lower Vertebrates: Goals and Tasks
• Laboratories: Laboratory for behavior and behavior ecology of mammals: Goals
• Laboratories: Laboratory for Soil Zoology and General Entomology: Goals and

... Supercomputing Technologies in Science, Education and Industry Almanac Series . ... Octotron: Active Control for Reliable Functioning of Supercomputers . ... DiMMon: a New Approach to Supercomputer Monitoring . ... X-COM: Distributed Computing Software . ... We propose a new approach to building distributed modular monitoring system named DiMMon, both for current and future systems, with an extremely high degree of parallelism. ... Research Computing Center (RCC) of Lomonosov Moscow State University...

Еще в разделе: (Показать все результаты (>69) - hpc.msu.ru/ )

• X-COM: DISTRIBUTED COMPUTING SOFTWARE | Moscow University Supercomputing Center
• APPLICATIONS: Theoretical Physics | Moscow University Supercomputing Center

... 2000 September 21 . XZ Tauri System Ejects Gas Bubble . ... Explanation: Why is the binary star system XZ Tauri emitting a hot bubble of expanding gas? ... The XZ Tauri star system is known to reside in the Taurus star forming region located about 500 light-years away. ... The bubble has been expanding over the past thirty years and now extends to nearly fifteen times the binary separation. Tomorrow's picture: Star Cluster . ... About APOD | ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: August 31, 1997 - Arp 230: Two Spirals in One?
• APOD: May 24, 1996 - In the Center of 30 Doradus
• APOD: 2000 July 13 - LP 944-20: A Failed Star Flares

CONTROL OF THE CHAOTIC OSCILLATIONS IN THE EXCITABLE MEDIUM IN ONE HETEROGENOUS CATALYTIC REACTION Kurkina E., Selezneva J. Mendeleev's University of Chemical Technologies of Russia, Miusskaya sq., ... Unpredictable behavior of the chaotic oscillations, ambiguity of ways of the process to end, high opportunity of realization the negative results leave us no choice but to look for the methods of controlling chaos. ... These reactions develop the chaotic behavior in definite conditions. ...

Еще в разделе: (Показать все результаты (>407) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc15825/doc.pdf
• http://www.mce.biophys.msu.ru/archive/doc21325/eng.pdf

... Early on, our interest in chirping analysis functions was motivated by a different kind of chirping phenomenon: chirping due to perspective. ... Our interest in radar, however, drew us toward processes that are more accurately analyzed by linear-FM chirplets. ... We have also constructed other chirplet transforms, such as a three-parameter Doppler chirplet representation that models a source producing a sinusoidal wave, while moving along a straight line (e.g. a train whistle). ...

Еще в разделе: (Показать все результаты (>6620) - crydee.sai.msu.ru/ )

• Dynamic HTML in Communicator
• "Can You Picture That"
• Moving Pictures Songlist

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... When detection of the change-points in alpha band power was performed as in the previous subsection, more than one change-point per second was obtained in average. ... The hypothesis of the hierarchy of EEG segmental descriptions (Kaplan 1998) (see subsection 7.3.2) is a theoretical reason for introducing the adjustment of the change-point detection probability. ...

Еще в разделе: (Показать все результаты (>77) - brain.bio.msu.ru/ )

• Other prospects of the change-point based analysis
• Analysis of change-point synchronization in multi-channel EEG
• Change-points in EEG components with different pattern

Use of humates to remediate polluted environments: . ... Picture gallery of the events . ... Use of different adsorbents (peats, sapropels, ceolites) in remediation technologies . ... Bezuglova, O.S. Use of humates and humate-enzyme complexes for the detoxification of soils contaminated with heavy metals. ... Coffee break . 11:00-12:00 . ... Theory and practice of humates use for remediation of polluted environments . ... Round table discussion: Working groups . ...

Еще в разделе: (Показать все результаты (>169) - mgumus.chem.msu.ru/ )

• Picture gallery of the participants and guests

... Main results of different objects studying using scanning probe microscopy methods are 3-dimensional images of these objects usually. ... It gives significantly more convenient image processing, but photographic quality, common for electronic microscopy methods was lost. Information obtained with scanning probe microscope is represented in a computer as numbers in 2 dimensional matrix. ... Thus, every matrix value is represented by point of some colour on a rectangular image. ... Averaging data . ...

Еще в разделе: (Показать все результаты (>149) - www.spm.genebee.msu.ru/ )

• Change in inner data representation

... The goal of our work was to study the particularities of the flower behavior of Nymphaea candida L. To reach this goal we marked these problems: . 1)To study the dynamics of the behavior of Nymphaea candida flowers. 2)To find the factors which cause the rhythmic behavior of the flowers and intensity of the bloom of Nymphaea candida . ... 4)To compare published material on biological rhythms of different plant species with our material on the behavior of Nymphaea candida flowers. ...

Еще в разделе: (Показать все результаты (>306) - herba.msu.ru/ )

• Living Pictures
• Pictures of the invertebrates
• Behaviour of white water-lily flowers in different photoperiods

... Лаборатория теоретической биофизики . ... ERG group members work with different types of molecules and consequently added new atomtypes into classical OPLS-AA distributed with GROMACS. ... OPLS-AA topology generation is a very complex task because of huge amount of the atomtypes described this force field. ... All-atom automatic OPLS-AA topology generator . ... comcon1 in All-atom automatic OPLS-AA topology? . ... OPLS-AA? in All-atom automatic OPLS-AA topology? ... 2012 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>60) - erg.biophys.msu.ru/ )

• comcon1 ERG Research Group: Лаборатория теоретической биофизики
• OPLS ERG Research Group: Лаборатория теоретической биофизики
• OPLS-AA patch for different types of molecules ERG Research Group: Лаборатория

... This is my main interest in linguistics that I have been pursuing for a number of years. ... Spoken language . Present-day linguistics is primarily oriented towards written language. ... I am personally interested in the latter kind of research since I prefer to use first-hand knowledge rather that crucially rely on how other people interpret languages (or still other people?s writings). ... This is one of the major languages of Russia spoken by dozens of thousands of people. ...

Еще в разделе: (Показать все результаты (>375) - www.philol.msu.ru/ )

• International Congress of Russian Language researches - preliminary program
• Speech rhythm in diachrony and synchrony
• http://www.philol.msu.ru/~otipl/new/main/people/kibrik-aa/ongoing_projects.html

Maria Davidich Personal Homepage . Maria Davidich . Scientific research . ... What else besides chaos, appealing to internal . ... Nowadays dynamical systems with chaotic behavior is attracting more and more attention. ... That's why in last decade new branch of theory of deterministic chaos, which is control and suppressing of chaos (or stabilizing chaotic behavior) attracts the attention of scientific community. ...

Еще в разделе: (Показать все результаты (>350) - polly.phys.msu.ru/ )

• Inna Malyshkina's personal page - Picture Gallery
• Science

by Margarita Dzhalalova It is known that the pressure difference values for a round parachute are constant over total canopy, then for a square parachute the values of pressure difference are non-uniform along radial ribbons differing even from each other and depending mainly on certain sets of line lengths, and therefore square parachutes attain different shapes from each other ( Fig.1 - photo of var.1 and var.2). ... Distribution of pressure coefficient along radial ribbons of square parachute. ...

Еще в разделе: (Показать все результаты (>9) - margaret.imec.msu.ru/ )

• Scientific Achievements
• Air-Permeability Influence on Pressure Distribution Character

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>236) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• TreeTop - Phylogenetic Tree prediction

... We proposed that information retrieved from the local surface photometric behavior of the Moon could be used for guiding the remote sensing analyses of specific geological targets. ... The value of the difference of intensities mentioned above may be used as a photometric parameter I of the local surface roughness. ... 7] Apollo 11 Prelim. ... Figure 5 represents the diagram of relationship between photometric roughness parameter and local thorium content in different lunar regions. ...

Еще в разделе: (Показать все результаты (>121) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Shev/Publications/ms38/ms083.pdf
• http://selena.sai.msu.ru/Bus/Publications/m44_14_busarev_etal.pdf
• http://selena.sai.msu.ru/Rod/Publications/ms34/MS060.pdf

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>13) - bioinf.fbb.msu.ru/ )

. To see a Russian version of this page, click here . (Professor, Director of SAI. Graduated from the Moscow State University (MSU) in 1964, Ph.D. 1967, MSU, Dr. of Science 1975, MSU) . A member of IAU and EAS, IAU committees No 42, 27. Fields of interest: Stellar astrophysics, close binary systems, inverse problems in astrophysics. Send your mail to: cher@sai.msu.su .

Еще в разделе: (Показать все результаты (>18) - uranus.sai.msu.ru/ )

• Elena Seifina
• Irina Glushneva