... We are grateful to Scott Atchley (Myricom) for providing us by benchmark data on this cluster. ... Press to visit PC GAMESS v. 7.0.7 benchmarks and scalability on large Opteron Pathscale Infinipath Infiniband Linux cluster page . Press to visit PC GAMESS v. 7.0.4 benchmarks and scalability on SKIF K-1000 (another large Opteron Infiniband Linux cluster) page . Press to visit PC GAMESS v. 7.0.4 benchmarks and scalability on 21-node Pentium 4 Infiniband Linux cluster page . ...

Еще в разделе: (Показать все результаты (>123) - classic.chem.msu.su/ )

• PC GAMESS benchmarks and scalability on SKIF K-1000 - large Infiniband Opteron
• PC GAMESS benchmarks and scalability on 21-node Infiniband Pentium 4 Linux
• PC GAMESS v. 7.0.4: Opteron Rev. E vs. Opteron Rev. F performance comparison

... Editor's choices for the most educational Astronomy Pictures of the Day about clusters of galaxies: . APOD: 2006 March 21 - The Coma Cluster of Galaxies . ... APOD: 2005 November 22 - A Galactic Collision in Cluster Abell 1185 . ... A prominent example occurs on the left of the above image of the rich cluster of galaxies Abell 1185. ... Recent observations of Abell 1185 have found unusual globular clusters of stars that appear to belong only to the galaxy cluster and not to any individual galaxy. ...

Еще в разделе: (Показать все результаты (>4551) - www.sai.msu.su/ )

• SNe related preprints
• Zen: Tycho
• SAL- Other Scientific Fields - Electrical Related Software - DAI Comparescan

... Close," however, is only relative to other clusters of galaxies , since light takes about 50 million years to reach us from A2199. All of the fuzzy objects in the above picture are galaxies , but these galaxies do not contain most of the matter in the cluster. By studying clusters like A2199, astronomers conclude that some form of dark matter dominates the motion of the bright galaxies. ... Publications with keywords: galaxy cluster . Publications with words: galaxy cluster . ...

Еще в разделе: (Показать все результаты (>16552) - www.astronet.ru/ )

• Inside the Coma Cluster of Galaxies
• Астронет > Galaxy Cluster A2199
• Thousands of Coma Cluster Galaxies

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>184) - www.genebee.msu.ru/ )

... About lab . ... The LidarK library provides an open-source framework for processing multidimensional point data such as 3D LIDAR scans. ... Download LidarK 2.0 , or browse for the previous versions and data samples . ... We called the data structure we designed Seg-Tree . ... GML LidarK Library v. 2.0 September 10, 2010 Download . GML LidarK Library v. 1.2 December 5, 2008 Download . GML LidarK Library v. 1.1 September 9,2008 Download . GML LidarK Library v. 1.0 July 1, 2008 Download . ...

Еще в разделе: (Показать все результаты (>233) - graphics.cs.msu.ru/ )

• GML LidarK Library | Лаборатория компьютерной графики и мультимедиа

... 2000 January 12 . NGC 6791: An Old, Large Open Cluster . ... Explanation: NGC 6791 is one of the oldest and largest open clusters of stars known. ... Open star cluster NGC 6791 , however, contains thousands of stars recently measured to be about 8 billion years old. ... This enigma makes NGC 6791, pictured above , one of the most studied open clusters and a possible example of how stars might evolve in the centers of galaxies. ... About APOD | ...

Еще в разделе: (Показать все результаты (>67) - www.arcetri.astro.it/ )

• APOD: December 13, 1997 - The Coma Cluster of Galaxies
• APOD: October 18, 1999 - NGC 3603: An Active Star Cluster

... Shapley H. - Studies of Magnitudes in Star Clusters VI. The Relation of Blue Stars and Variables to Galactic Planes . ... Название: Studies of Magnitudes in Star Clusters VI. ... Автор: Shapley H. Язык: . ...

Еще в разделе: (Показать все результаты (>15687) - lib.mexmat.ru/ )

• Oort J.H. - On a Possible Relation between Globular Clusters and Stars of High
• Barus C. - On a Comparison of the Relative Sensitiveness of Telephones ::
• Shapley H. - Studies of Magnitude in Star Clusters VII. A Method for the

ABSOLUTE PROPER MOTIONS OF 331 OPEN CLUSTERS . ... The proper motions of stars in the fields of 331 open clusters were taken from Four-Million Star Catalog (4M-catalog) of positions and proper motions (Volchkov et al. ... The absolute proper motions for 21 young open clusters have been derived by comparison of precise relative proper motions of individual stars and their corresponding absolute proper motions. ... Sign of proper motions in RA . ... 0.0001 arcsec/yr . ... rms error in RA proper motion . ...

Еще в разделе: (Показать все результаты (>32) - www.sai.msu.ru/ )

... On peculiarities of using heterogeneous cluster architecture for solving continuum mechanics problems" . Gubaidullin D.A., Nikiforov A.I., Sadovnikov R.V. The use of high-performance computing systems built on the basis of NVIDIA graphics processors is discussed. ... Keywords: parallel computing, graphics processors, iterative Krylov subspace methods, method of control volumes, flow in porous media . PostScript (in Russian) (5.82MB) . PDF (in Russian) (658KB) . ...

Еще в разделе: (Показать все результаты (>469) - num-meth.srcc.msu.ru/ )

• "The 3D-computer cluster simulation of forming the large-sized one-piece
• "Integration of Fuzzy c-Means Clustering algorithm with PostgreSQL database
• "Solving the Boltzmann kinetic equation using tetrahedral meshes on a cluster

. Kudryashov S.I. , Zorov N.B. Mendeleev Communications, p. 178 (1998). Abstract . The electric probe procedure developed here has made it possible to detect for the first time large cluster ions, the products of spinodal decomposition of the laser-induced labile state of the liquid phase of carbon, with a size up to a million atoms and relative content in the mass distribution of the order of ppm. Laboratory of Laser Diagnostics

Еще в разделе: (Показать все результаты (>951) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 48, No. 1, P. 27 (2007)
• Moscow University Chemistry Bulletin Vol. 50, No. 1, P. 9 (2009)
• Moscow University Chemistry Bulletin Vol. 49, No. 3, P. 203 (2008)

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>292) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/215.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/129.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/106.pdf

Microsymposium 38, MS083, 2003 (A4 format) MERCURY: LOCAL VARIATIONS OF THE PHOTOMETRIC RELIEF. ... Because of trajectory and pointing angle constraints the planet could be observed from Mariner 10 only over a small range of phase angles between about 75o and 110o. Therefore the photometric investigations are restricted to measuring the distribution of brightness on the Mercurian disk. ... Raw versions of real-time processing pictures FDS 0000984 and FDS 0000986 were used (images 196 and 202). ...

Еще в разделе: (Показать все результаты (>106) - selena.sai.msu.ru/ )

Mitigating Activity of Humic Substances and their Si-enriched Derivatives in relation to Wheat Seedlings under Salt-Stress Condition Olga I. Philippova1, Natalia A. Kulikova1, Leonid A. Karpiouk2, Galina F.Lebedeva1, Irina V. Perminova 1 2 Department of Soil Science, Lomonosov Moscow State University, 119992, Moscow, Russia, Department of Chemistry, Lomonosov Moscow State University, 119992, Moscow, Russia philippova@soil.msu.ru 2 Keywords: humic, bioactivity, silicium, stress 1. ...

Еще в разделе: (Показать все результаты (>132) - mgumus.chem.msu.ru/ )

• http://www.mgumus.chem.msu.ru/publication/2008/2008-kulikova-detoxifying.pdf

Find Similar Abstracts . ... The velocity of clusters of galaxies relative to the microwave background. ... BACKGROUND RADIATION, GALACTIC CLUSTERS, MICROWAVE SCATTERING, VELOCITY MEASUREMENT, HIGH TEMPERATURE GASES, MICROWAVES, POLARIZED RADIATION, RADIAL VELOCITY, RADIO ASTRONOMY, THOMSON SCATTERING . ... Use: Authors Title Abstract Text Text Query with Keywords Return: Query Results Query Form Database: Astronomy Instrumentation Physics and Geophysics ABSTRACT QUERY USER FEEDBACK HELP ...

Еще в разделе: (Показать все результаты (>443) - xray.sai.msu.ru/ )

• Discussion and conclusions
• The COOC Criterion (Criterion of Observations versus Calculations)
• Restrictions on the Scenario Parameters

... 4.3 Scoring Matrices A two-dimensional matrix containing all possible pair-wise amino acid scores is called a scoring matrix. Scoring matrices are also called substitution matrices because the scores represent relative rates of evolutionary substitutions. Scoring matrices are evolution in a nutshell. ... 4.3.1 PAM and BLOSUM Matrices Two different kinds of amino acid scoring matrices, PAM (Percent Accepted Mutation) and BLOSUM (BLOcks SUbstitution Matrix), are in wide use. ...

Еще в разделе: (Показать все результаты (>1318) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~anuta_al/projects/Photobacterium%20profundum.doc

... Uniform Resource Locators (URLs) . ... Relative URLs . URLs in HTML . ... Every resource available on the Web --- HTML document, image, video clip, program, etc. --- has an address that may be encoded by a Uniform Resource Locator , or "URL" (defined in [RFC1738] ). ... This URL may be read as follows: Use the HTTP protocol (see [RFC2068] ) to transfer the data residing on the machine www.w3.org in the file "/TR/WD-html4/cover.html". ... Relative URLs are resolved to full URLs using a base URL. ...

Еще в разделе: (Показать все результаты (>436) - itpm.msu.su/ )

• The DNS Database Files
• Linux Administration Made Easy: Help! Trouble in Paradise!
• Allocating disk space

COMPARISON OF CLUSTERING ALGORITHMS FOR SPEAKER IDENTIFICATION Nikolay Lubimov, Evgeny Mikheev, Alexey Lukin Moscow Lomonosov State University, Moscow, Russia In this paper we consider the problem of text-independent speaker identification that refers to acoustic recognition research. ... We have performed the comparison of different clustering methods for speaker identification: the standard K-means clustering, K-means++, Linde-Buzo-Gray, Fuzzy C-means, and Gustafson-Kessel algorithms. ...

Еще в разделе: (Показать все результаты (>168) - imaging.cmc.msu.ru/ )

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>133) - bioinf.fbb.msu.ru/ )

• Site Cluster
• SDPlight
• RNA Kinetics: Theory

... A document window is shown, with 8 lines (numbered 1 to 8), each 24px high. The text of the "outer" box (at the end of line 1, halfway into line 2, and halfway into line 3) is shifted upward 12px. The text of the "inner" box, thought shifted upward as well, has been relatively positioned so that it lies in its normal flow position at the end of line 2. ... The lines, as they appear in the image, contain: Start 1 Beginning of body contents. 2 of outer contents. Inner contents. ...

Еще в разделе: (Показать все результаты (>4027) - crydee.sai.msu.ru/ )

• RELATED WORK
• Long description illustrating absolute positioning with respect to the initial
• Long description for example illustrating positioning with respect to a

... E-MAIL ADDRESS: D.Khmelev@newton.cam.ac.uk . A new statistical method in the analysis of literary style for disputed authorship resolution is considered here. ... Consider a sequence of letter of text as a Markov chain. ... Suppose we take the logarithm of each probability, change a sign, and divide it by the length of control text; then each of the numbers obtained is called the relative empirical entropy . Relative empirical entropy is more convenient for computing than actual probabilities. ...

Еще в разделе: (Показать все результаты (>59) - old.philol.msu.ru/ )

• Large transportation networks with finite-dimensional state space. Asimptotic
• MSU-LGCLL:: Anatoliy A. Polikarpov - Some Factors and Regularities of