... We are grateful to Scott Atchley (Myricom) for providing us by benchmark data on this cluster. ... Press to visit PC GAMESS v. 7.0.7 benchmarks and scalability on large Opteron Pathscale Infinipath Infiniband Linux cluster page . Press to visit PC GAMESS v. 7.0.4 benchmarks and scalability on SKIF K-1000 (another large Opteron Infiniband Linux cluster) page . Press to visit PC GAMESS v. 7.0.4 benchmarks and scalability on 21-node Pentium 4 Infiniband Linux cluster page . ...

Еще в разделе: (Показать все результаты (>118) - classic.chem.msu.su/ )

• PC GAMESS benchmarks and scalability on SKIF K-1000 - large Infiniband Opteron
• PC GAMESS v. 7.1.1 benchmarks and scalability on Infiniband Opteron Windows CCS
• PC GAMESS benchmarks and scalability on 21-node Infiniband Pentium 4 Linux

Swiss PDBViewer . Swiss-PdbViewer is an application that provides a user friendly interface allowing to analyse several proteins at the same time. ... Swiss-PdbViewer can also read electron density maps, and provides various tools to build into the density. In addition, various modelling tools are integrated and command files for popular energy minimization packages can be generated. ... None . ... SAL Home | Other Scientific Fields | Chemistry, Biology Related . ...

Еще в разделе: (Показать все результаты (>4546) - www.sai.msu.su/ )

• APOD Index - Galaxies: Clusters of Galaxies
• SAL- Other Scientific Fields - Electrical Related Software - DAI Comparescan
• Отдел Изучения Галактики и переменных звезд

... 21.02.2011 . ... Credit Copyright: morn1415 (YouTube) Explanation: How big is our Sun compared to other stars? In a dramatic and popular video featured on YouTube , the relative sizes of planets and stars are shown from smallest to largest. ... Note that the true sizes of most stars outside of the Sun and Betelgeuse are not known by direct observation, but rather inferred by measurements of their perceived brightness , temperature , and distance. ... Publications with keywords: star - planet . ...

Еще в разделе: (Показать все результаты (>15567) - www.astronet.ru/ )

• Inside the Coma Cluster of Galaxies
• Galaxy Cluster A2199
• Journal "Peremennye Zvezdy"

... Shapley H. - Studies of Magnitudes in Star Clusters VI. The Relation of Blue Stars and Variables to Galactic Planes . ... Название: Studies of Magnitudes in Star Clusters VI. ... Автор: Shapley H. Язык: . ...

Еще в разделе: (Показать все результаты (>14136) - lib.mexmat.ru/ )

• Oort J.H. - On a Possible Relation between Globular Clusters and Stars of High
• Barus C. - On a Comparison of the Relative Sensitiveness of Telephones ::
• Shapley H. - Studies of Magnitude in Star Clusters VII. A Method for the

... On peculiarities of using heterogeneous cluster architecture for solving continuum mechanics problems" . Gubaidullin D.A., Nikiforov A.I., Sadovnikov R.V. The use of high-performance computing systems built on the basis of NVIDIA graphics processors is discussed. ... Keywords: parallel computing, graphics processors, iterative Krylov subspace methods, method of control volumes, flow in porous media . PostScript (in Russian) (5.82MB) . PDF (in Russian) (658KB) . ...

Еще в разделе: (Показать все результаты (>477) - num-meth.srcc.msu.ru/ )

• "The 3D-computer cluster simulation of forming the large-sized one-piece
• "Integration of Fuzzy c-Means Clustering algorithm with PostgreSQL database
• "Solving the Boltzmann kinetic equation using tetrahedral meshes on a cluster

. Kudryashov S.I. , Zorov N.B. Mendeleev Communications, p. 178 (1998). Abstract . The electric probe procedure developed here has made it possible to detect for the first time large cluster ions, the products of spinodal decomposition of the laser-induced labile state of the liquid phase of carbon, with a size up to a million atoms and relative content in the mass distribution of the order of ppm. Laboratory of Laser Diagnostics

Еще в разделе: (Показать все результаты (>881) - chem.msu.ru/ )

• Determination of Reaction Rate Constants in Micelles. A Comparison of the

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>284) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/129.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/106.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/215.pdf

Find Similar Abstracts . ... The velocity of clusters of galaxies relative to the microwave background. ... BACKGROUND RADIATION, GALACTIC CLUSTERS, MICROWAVE SCATTERING, VELOCITY MEASUREMENT, HIGH TEMPERATURE GASES, MICROWAVES, POLARIZED RADIATION, RADIAL VELOCITY, RADIO ASTRONOMY, THOMSON SCATTERING . ... Use: Authors Title Abstract Text Text Query with Keywords Return: Query Results Query Form Database: Astronomy Instrumentation Physics and Geophysics ABSTRACT QUERY USER FEEDBACK HELP ...

Еще в разделе: (Показать все результаты (>428) - xray.sai.msu.ru/ )

• The COOC Criterion (Criterion of Observations versus Calculations)
• Restrictions on the Scenario Parameters

... The behaviour of this extension, including the names of its functions, and anything else documented about this extension may change in a future release of PHP without notice. Be warned and use this extension at your own risk. db++, made by the german company Concept asa , is a relational database system with high performance and low memory and disk usage in mind. ... The record is write locked . ... ERR_LOCKED . ... Write error on relation . ... dbplus_getlock -- Get a write lock on a tuple . ...

Еще в разделе: (Показать все результаты (>415) - oit.cmc.msu.ru/ )

• History of PHP related projects
• dbx_compare
• Hints on Running a High-Performance Web Server

COMPARISON OF CLUSTERING ALGORITHMS FOR SPEAKER IDENTIFICATION Nikolay Lubimov, Evgeny Mikheev, Alexey Lukin Moscow Lomonosov State University, Moscow, Russia In this paper we consider the problem of text-independent speaker identification that refers to acoustic recognition research. ... We have performed the comparison of different clustering methods for speaker identification: the standard K-means clustering, K-means++, Linde-Buzo-Gray, Fuzzy C-means, and Gustafson-Kessel algorithms. ...

Еще в разделе: (Показать все результаты (>164) - imaging.cmc.msu.ru/ )

... E-MAIL ADDRESS: D.Khmelev@newton.cam.ac.uk . A new statistical method in the analysis of literary style for disputed authorship resolution is considered here. ... Consider a sequence of letter of text as a Markov chain. ... Suppose we take the logarithm of each probability, change a sign, and divide it by the length of control text; then each of the numbers obtained is called the relative empirical entropy . Relative empirical entropy is more convenient for computing than actual probabilities. ...

Еще в разделе: (Показать все результаты (>56) - old.philol.msu.ru/ )

ABSOLUTE PROPER MOTIONS OF 331 OPEN CLUSTERS . ... The proper motions of stars in the fields of 331 open clusters were taken from Four-Million Star Catalog (4M-catalog) of positions and proper motions (Volchkov et al. ... The absolute proper motions for 21 young open clusters have been derived by comparison of precise relative proper motions of individual stars and their corresponding absolute proper motions. ... Sign of proper motions in RA . ... 0.0001 arcsec/yr . ... rms error in RA proper motion . ...

Еще в разделе: (Показать все результаты (>32) - www.sai.msu.ru/ )

... Related tools . Up: Debugging MPI programs Next: Contents of the library files Previous: Attaching debugger to a running program . The Scalable Unix Tools (SUT) is a collection for managing workstation networks as a MPP. These include programs for looking at all of the processes in a cluster and performing operations on them (such as attaching the debugger to every process you own that is running a particular program). ... Центры . ...

Еще в разделе: (Показать все результаты (>521) - www.parallel.ru/ )

• Installation Guide to mpich,a Portable Implementation of MPI | PARALLEL.RU -

... Second-year students classes . ... The course offers profound description of popular techniques of parallel programming such as OpenMP and MPI. ... Rapid growth of productivity of the modern computing systems is achieved by using parallel processors and multicore systems. ... As a result, by the and this course, students acquire knowledge about the popular parallel programming techniques, knowledge of modern high-performance computing systems and practical skills to work with them. ... Moscow: Binom...

Еще в разделе: (Показать все результаты (>81) - engineering.phys.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>176) - www.genebee.msu.ru/ )

• GEA :: Gene Expression Analysis
• DIMACS Series in Discrete Mathematics
• AliComp - GeneBee Alignments Comparison - Advanced

... About lab . ... The LidarK library provides an open-source framework for processing multidimensional point data such as 3D LIDAR scans. ... Download LidarK 2.0 , or browse for the previous versions and data samples . ... We called the data structure we designed Seg-Tree . ... GML LidarK Library v. 2.0 September 10, 2010 Download . GML LidarK Library v. 1.2 December 5, 2008 Download . GML LidarK Library v. 1.1 September 9,2008 Download . GML LidarK Library v. 1.0 July 1, 2008 Download . ...

Еще в разделе: (Показать все результаты (>248) - graphics.cs.msu.ru/ )

• GML LidarK Library | Лаборатория компьютерной графики и мультимедиа

. [ Войти ] . Главная -> Фильмы -> It's All Relative . Пользователи . Демо . Деньги . Фильмы . Форум . It's All Relative . США 2003 . отметить . Сериал . Мелодрама . Комедия .

Еще в разделе: (Показать все результаты (>82) - kinfo.ru/ )

• Relative Strangers - Фильмы - Kinfo.ru
• Relative Fear - Фильмы - Kinfo.ru
• Everything Relative - Фильмы - Kinfo.ru

Nominal modification at the Syntax-Semantics Interface: comparing attributive adjectives in Italian and English In his seminal work, Bolinger (1967) discusses an asymmetry between two functions that adjectives can perform, namely attributive and predicative modification; furthermore, he points out that the syntactic asymmetry between the pre- and the post-nominal position of a number of adjectives in English is related to a semantic difference between reference- and referentmodification, respectively. ...

Еще в разделе: (Показать все результаты (>282) - www.philol.msu.ru/ )

. You can define a file or directory by its location in relation to your current directory . The pathname is given as / (slash) separated list of the directories on the route to the file (or directory) from your current directory. A .. (dot dot) is used to represent the directory immediately above the current directory. In all shells except the Bourne shell, the ~ (tilde) character can be used as shorthand for the full pathname to your home directory. Examples . Did You Know? .

Еще в разделе: (Показать все результаты (>130) - comet.sai.msu.ru/ )

• Examples of using relative pathnames
• Did You Know?
• Comparing files under SCCS control

... Performance System Analysis . HOPSA - the joint RF/EU project: HOlistic Performance System Analysis . ... The tool of this type is being developed in the Laboratory of Parallel Informational Technologies of Research Computing Center of Lomonosov Moscow State University. ... The HOPSA project (HOListic Performance System Analysis) therefore sets out for the first time for combined application and system tuning developing an integrated diagnostic infrastructure. ... Joint MSU-Intel Center . ...

Еще в разделе: (Показать все результаты (>69) - hpc.msu.ru/ )

• GPU Center of Excellence | Moscow University Supercomputing Center
• CLEO: USER & ADMIN-FRIENDLY CLUSTER BATCH SYSTEM | Moscow University
• MSU SUPERCOMPUTERS: IBM BLUE GENE /P | Moscow University Supercomputing Center