... Test 1, Opteron 285 (Rev. E) 2.6 GHz, CPU time, . ... 2600 . ... Test 1, Opteron 2220 SE (Rev. F) 2.8 GHz, CPU time, . ... Test 2, Opteron 285 (Rev. E) 2.6 GHz, Wall clock time, . ... Test 2, Opteron 2220 SE (Rev. F) 2.8 GHz, Wall clock time, . ... Test 5 (PC GAMESS version 7.0.3 code), Opteron 285 (Rev. E) 2.6 GHz, CPU time, . ... Test 5 (PC GAMESS version 7.0.3 code), Opteron 2220 SE (Rev. F) 2.8 GHz, CPU time, . ... Press to visit PC GAMESS' eight core systems performance comparison page . ...

Еще в разделе: (Показать все результаты (>120) - classic.chem.msu.su/ )

• Two years later: Firefly version 8.0.0 beta benchmarks on Intel Core i7 2600K
• Hyperthreading that works: PC GAMESS/Firefly v. 7.1.F benchmarks on Intel Core
• Fair comparison: PC GAMESS/Firefly v. 7.1.E benchmarks on Intel Core 2 Quadro

... 6.06.2013 . ... Credit Copyright: morn1415 (YouTube) Explanation: How big is our Sun compared to other stars? In a dramatic and popular video featured on YouTube , the relative sizes of planets and stars are shown from smallest to largest. ... Note that the true sizes of most stars outside of the Sun and Betelgeuse are not known by direct observation, but rather inferred by measurements of their perceived brightness , temperature , and distance. ... Publications with keywords: star - planets . ...

Еще в разделе: (Показать все результаты (>6357) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• Henrietta Leavitt Calibrates the Stars
• Global Warming Predictions

DAI Comparescan . ... Comparescan is a simulation comparison tool that compares a "golden" simulation set to another simulation set. Comparescan is a full featured comparison tool that computes far more than simple signal comparison. The comparison criteria is specified in a Comparison Rules File. ... Home Site: . ... Software/Hardware Requirements: . ... http://www.designacc.com/ (DAI Home Page) . ... SAL Home | Other Scientific Fields | Electrical Related Software . ...

Еще в разделе: (Показать все результаты (>2487) - www.sai.msu.su/ )

• SAL- Other Scientific Fields - Chemistry, Biology Related - Dotter
• APOD: 2013 June 6 - Star Size Comparisons
• APOD: 2011 February 22 - Star Size Comparisons

Электронная библиотека Попечительского совета . ... Barus C. - On a Comparison of the Relative Sensitiveness of Telephones . ... Название: On a Comparison of the Relative Sensitiveness of Telephones . Автор: Barus C. Язык: . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>10545) - lib.mexmat.ru/ )

• Поиск книг, содержащих Relative error :: Электронная библиотека попечительского
• Поиск книг, содержащих Расслоение относительное кокасательное (relative
• Поиск книг, содержащих Внутренность относительная (relative interior) ::

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>147) - www.genebee.msu.ru/ )

... E-MAIL ADDRESS: D.Khmelev@newton.cam.ac.uk . A new statistical method in the analysis of literary style for disputed authorship resolution is considered here. ... Consider a sequence of letter of text as a Markov chain. ... Suppose we take the logarithm of each probability, change a sign, and divide it by the length of control text; then each of the numbers obtained is called the relative empirical entropy . Relative empirical entropy is more convenient for computing than actual probabilities. ...

Еще в разделе: (Показать все результаты (>48) - old.philol.msu.ru/ )

. You can define a file or directory by its location in relation to your current directory . The pathname is given as / (slash) separated list of the directories on the route to the file (or directory) from your current directory. A .. (dot dot) is used to represent the directory immediately above the current directory. In all shells except the Bourne shell, the ~ (tilde) character can be used as shorthand for the full pathname to your home directory. Examples . Did You Know? .

Еще в разделе: (Показать все результаты (>106) - comet.sai.msu.ru/ )

• Examples of using relative pathnames
• Did You Know?
• Comparing files under SCCS control

. [ Войти ] . Главная -> Фильмы -> It's All Relative . Пользователи . Демо . Деньги . Фильмы . Форум . It's All Relative . США 2003 . отметить . Сериал . Мелодрама . Комедия .

Еще в разделе: (Показать все результаты (>221) - kinfo.ru/ )

• Relative Fear - Фильмы - Kinfo.ru
• Relative Strangers - Фильмы - Kinfo.ru
• Relative Chaos - Фильмы - Kinfo.ru

... A document window is shown, with 8 lines (numbered 1 to 8), each 24px high. The text of the "outer" box (at the end of line 1, halfway into line 2, and halfway into line 3) is shifted upward 12px. The text of the "inner" box, thought shifted upward as well, has been relatively positioned so that it lies in its normal flow position at the end of line 2. ... The lines, as they appear in the image, contain: Start 1 Beginning of body contents. 2 of outer contents. Inner contents. ...

Еще в разделе: (Показать все результаты (>3225) - crydee.sai.msu.ru/ )

• Image: Nijo castle, Shogun palace. The main building. Comparing to temples and
• RELATED WORK
• Dynamic HTML in Communicator

. Title: . [Carnosine and relative compounds protect double-stranded DNA from oxidative damage]. Authors: . Leinsoo TA; Abe H; Boldyrev AA . Publication: . Zh Evol Biokhim Fiziol. 2006 Sep-Oct;42(5):453-6. PubmedID . 17087009 . Abstract . None

Еще в разделе: (Показать все результаты (>45) - biochem.bio.msu.ru/ )

• [Admission and predischarge levels of NT pre brain natriuretic peptide in

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>228) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/214.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/215.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/128.pdf

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . ... Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: but given her relative aloof nature, she . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . Вы не можете публиковать новые темы в этом форуме . ...

Еще в разделе: (Показать все результаты (>3130) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: relative Broadley), the
• Экологический Форум - Фундаментальная Экология: the $ that relative This
• Экологический Форум - Фундаментальная Экология: Price Compare Website

... Uniform Resource Locators (URLs) . ... Relative URLs . URLs in HTML . ... Every resource available on the Web --- HTML document, image, video clip, program, etc. --- has an address that may be encoded by a Uniform Resource Locator , or "URL" (defined in [RFC1738] ). ... This URL may be read as follows: Use the HTTP protocol (see [RFC2068] ) to transfer the data residing on the machine www.w3.org in the file "/TR/WD-html4/cover.html". ... Relative URLs are resolved to full URLs using a base URL. ...

Еще в разделе: (Показать все результаты (>250) - itpm.msu.su/ )

• The DNS Database Files
• Domain Name Service Related Items
• MySQL Reference Manual for version 3.23.10-alpha. - 21 How MySQL compares to

PHP Manual . ... int dbx_compare ( array row_a, array row_b, string columnname_or_index [, int flags]) . ... This function is EXPERIMENTAL . ... Returns 0 if row_a[$columnname_or_index] is equal to row_b[$columnname_or_index], 1 if it is greater and -1 if it is smaller (or vice versa if the DBX_CMP_DESC flag is set). The flags can be set to specify comparison direction (whether sorting is ascending or descending) and comparison type (force string or numeric compare by converting the data). ...

Еще в разделе: (Показать все результаты (>298) - oit.cmc.msu.ru/ )

• version_compare
• mcal_date_compare
• ldap_compare

How do Linux Threads compare with other OSs'? ... Solaris . ... Priority Scheduling [1] . ... Mutex Attributes . ... Thread Attributes . ... Posix and Solaris link thread priorities with mutexes and use the priority of a blocked thread's mutex to alter the priority of the blocking thread. Win32 and Linux let the scheduler determine what thread to elevate in priority. ... Solaris implements it because they need it: the program can change certain thread's attributes unless it is suspended. ...

Еще в разделе: (Показать все результаты (>383) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QByteArray Class
• Hints on Running a High-Performance Web Server
• Apache module mod_include

... Mazza T. , Gryzlova E.V. , Grum-Grzhimailo A.N. , Kazansky A.K. , Kabachnik N.M. , Meyer M. в журнале Journal of Electron Spectroscopy and Related Phenomena , издательство Elsevier BV (Netherlands) , том 204, с. 313-321 DOI . ... Gryzlova E.V. , Grum-Grzhimailo A.N. , Staroselskaya E.I. , Strakhova S.I. в журнале Journal of Electron Spectroscopy and Related Phenomena , издательство Elsevier BV (Netherlands) , том 204, с. 277-283 DOI . ...

Еще в разделе: (Показать все результаты (>1715) - istina.msu.ru/ )

• Metrologia - журнал | ИСТИНА - Интеллектуальная Система Тематического
• Phosphorus, Sulfur and Silicon and the Related Elements - журнал | ИСТИНА -
• Compare - журнал | ИСТИНА - Интеллектуальная Система Тематического Исследования

... Cube : Re: Покажи буфер, или же Current буфер [re:_Ss_] 26.03.2009 16:20 | ... http://dell2:8180/forum/user/?act=profile&u_id=8&wha.. ... http://forum.izvestia.ru/board10/topic60859/?page=1 . ... Relative enthropy for encoding 'Russian.UTF-8' is infinity . ... Relative enthropy for encoding 'Russian.cp1251' is infinity . ... It seems to me that memory allocation/deallocation for func cache occurs only once during program run-time. ... class wtfFilesDropTarget : public wxTextDropTarget . ...

Еще в разделе: (Показать все результаты (>1700) - www.fds-net.ru/ )

• Операция Set relation над таблицами - Public forum of MSU united student
• html, разница при отображении в разных браузерах - Public forum of MSU united

Canidae . ... Analysis of variation of the cheek teeth in three canid species (Mammalia: Canidae) by means of standard and geometric morphometrics Zoological Museum of Moscow University Several methods of minimizing size from overall variation are compared, which are shape variables of geometric morphometrics, two methods of data standardization (by character means and by specimen centroids), and principal component analysis. ... Rohlf, 1986; Bookstein, 1991; Navarro et al., ... 414 Canidae . ... Vol. ...

Еще в разделе: (Показать все результаты (>1208) - zmmu.msu.ru/ )

• Russian Journal of Theriology
• Shoulder girdle and forelimb myology of extant Monotremata
• Scent marking in gerbils and its possible functions

Another mechanical model of parametrically excited pendulum and stabilization of its inverted equilibrium position Anton O. Belyakov 1 Lomonosov Moscow State University 2 Vienna University of Technology 8th European Nonlinear Dynamics Conference (ENOC 2014) Vienna, July 7, 2014 Scheme of a parametric pendulum y O l (t ) - g m 2 r1 + m 2 Equations of motion mr 2 1 d d2 + c1 + m g l (t ) sin () = 0 dt 2 dt (1) Dimensionless equation Three dimensionless parameters and ...

Еще в разделе: (Показать все результаты (>9) - belyakov.imec.msu.ru/ )

Lomonosov Moscow State University was established in 1755 . ... Lomonosov Moscow State University Diary . ... MSU Online . ... More than 40 000 students (graduate and postgraduate) and about 7 000 undergraduates study at the university, and over 5 000 specialists do the refresher course here. ... Moscow University campus is an extremely complex system, with its 1 000 000 m2 floor area in 1 000 buildings and structures, with its 8 dormitories housing over 12 000 students and 300 km of utility lines. ...

Еще в разделе: (Показать все результаты (>191) - www.msu.ru/ )

• International Relations
• Information for applicants