Options can be grouped together: ls -FI . ... Directories are shown with a trailing '/'; files which have execute permission are shown with a trailing '*'. ... Some options need to be given separately: lpr -Plp2 -#4rm report.ps . This prints four copies of the file report.ps , removes the file and sends mail to the user on completion. The option -Plp2 which specifies the printer to be used is given separately from the other options. If the command were given as lpr -Plp2#4rm report.ps . ...

Еще в разделе: (Показать все результаты (>840) - comet.sai.msu.ru/ )

• SYNOPSIS
• Examples of commands

Sternberg Astronomical Institute, Moscow University, . Moscow, Russia . Supernovae make us brighter .. Search russian astronomical resources . Mirror of International Supernovae Network ( Original site ) . Catalogue of Supernovae Stars . HTTP access to SAI Catalogue of Supernovae Stars . SAI SN Light Curves Online . ... Sternberg Astronomical Institute ( in Russian ) . ... Astronet - Russian Astronomical Network . ... Russian Foundation for Basic Research . ...

Еще в разделе: (Показать все результаты (>5821) - www.sai.msu.su/ )

• Zen: 2005-10-27
• Отдел Изучения Галактики и переменных звезд
• xntpd - Network Time Protocol (NTP) daemon

... For example, any option which requires a parameter is such a case. ... Postel & Reynolds [Page 2] RFC 855 May 1983 Thus, for option "ABC", which requires subnegotiation, the formats of the TELNET commands are: IAC WILL ABC Offer to use option ABC (or favorable acknowledgment of other party's request) IAC DO ABC Request for other party to use option ABC (or favorable acknowledgment of other party's offer) IAC SB ABC <parameters> IAC SE One step of subnegotiation, used by either party. ...

Еще в разделе: (Показать все результаты (>28116) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc855.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc490.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc859.txt

Firefly version 8.0 and above supports two new parallel modes of execution, namely the standard e X treme P arallel ( XP ) and extended XP modes. ... In the standard parallel mode, there exists only a single master process. ... In the extended XP mode, there are several groups of processes, each group consisting of its own local master and slave processes. ... Firefly's P2P interface and dynamic load balancing over P2P can be used in any of three parallel modes of execution. ...

Еще в разделе: (Показать все результаты (>114) - classic.chem.msu.su/ )

• Firefly v. 8.0.0 documentation - numerical gradients
• Firefly DOCUMENTATION - command line arguments
• Firefly/PC GAMESS DOCUMENTATION - NEW MP2 GRADIENT CODE

... Inter-Communication Examples . ... Therefore, group 0 requires one inter-communicator, group 1 requires two inter-communicators, and group 2 requires 1 inter-communicator. main(int argc, char **argv) { MPI_Comm myComm; /* intra-communicator of local sub-group */ MPI_Comm myFirstComm; /* inter-communicator */ MPI_Comm mySecondComm; /* second inter-communicator (group 1 only) */ int membershipKey; int rank; . ... Build inter-communicators. ... int buffer[10], rank; int local_leader = 0; . ... Центры ....

Еще в разделе: (Показать все результаты (>900) - www.parallel.ru/ )

• Inter-communicator Operations | PARALLEL.RU - Информационно-аналитический центр
• Library Example #2 | PARALLEL.RU - Информационно-аналитический центр по
• MPI's Support for Libraries | PARALLEL.RU - Информационно-аналитический центр

... Physics Department . ... Main building, auditorium 02 . at option (extra) . ... Philippova O.E. Vital directions of polymer and crystal physics . Phys. Dept., auditorium С-25 . ... Khokhlov A.R., Philippova O.E., Tamm M.V. Introduction to polymer science . ... at option . ... Rashkovich L.N., Belyaev O.A. Material crystal physics . ... Kaznacheev A.V. Physics of liquid crystals . ... Khokhlov A.R. State of the art of polymer and crystal physics . ... Seminar in Polymer Physics . ...

Еще в разделе: (Показать все результаты (>295) - polly.phys.msu.ru/ )

... View r21 > r20 .. ... Restricting read and write access to topics and webs, by users and groups . ... TWikiAccessControl allows you restrict access to single topics and entire webs, by individual user and by user groups, in three main areas: view; edit & attach; and rename/move/delete. ... Changed: . ... When a user accesses a web where you enabled view restriction, TWiki will redirect from the view script to the viewauth script once (this happens only if the user has never edited a topic). ...

Еще в разделе: (Показать все результаты (>47022) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (21 vs. 22) - TWiki
• BulkRegistration - TWiki - TWiki
• TWikiAccessControl - TWiki - TWiki

О лаборатории . ... Лаборатория теоретической биофизики . ... This Python module parses Gaussian cube files, produced by quite a few QM software packages, and makes volume data available as numpy array as well as some associated properties. ... Нет комментариев " Gaussian Cube files loader " . ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>59) - erg.biophys.msu.ru/ )

• Normal modes visualization for PyMol ERG Research Group: Лаборатория
• Nanotubes generating script for PyMol ERG Research Group: Лаборатория
• Using spherical functions (from A.Granovsky manual) ERG Research Group:

Formatrpsdb: Build databases for RPS Blast Introduction ------------ Formatrpsdb is a utility that converts a collection of input sequences into a database suitable for use with Reverse Position Specific (RPS) Blast. Each input sequence, together with its position-specific scoring matrix (PSSM), is ASN.1 encoded into a PssmWithParameters (or 'scoremat') object and resides in a separate file. ... An RPS Blast database consists of two groups of files. ...

Еще в разделе: (Показать все результаты (>4100) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.su/trac/tanchiki/wiki/TracIni?version=1&format=txt
• http://kodomo.cmm.msu.ru/~turaro/term2/text/Prac1/ls.txt
• http://kodomo.cmm.msu.ru/~plazmoliz/Term3/sup/man_ls.help

Maximum RPM: Taking the Red Hat Package Manager to the Limit . ... One or more RPM package files (URLs OK) . ... Install documentation . ... the section called --replacefiles : Install the Package Even If It Replaces Another Package's Files . ... RPM turns that process into a single command. rpm -i ( --install is equivalent) installs software that's been packaged into an RPM package file. ... Every time RPM installs a package on your system, it keeps track of the files it installed, in its database. ...

Еще в разделе: (Показать все результаты (>1300) - uneex.lorien.cs.msu.su/ )

• Query Mode
• Getting Information About Packages
• mod_auth - Apache HTTP Server

This home page belongs to small group of scientists working at . Sternberg Astronomical Institute which is a part of Moscow State University . ... Электронная библиотека научно-технической и художественной литературы (доступна только из ГАИШ) . ... Local staff . Dr. Edward Kononovich (konon -at- sai.msu.ru), Associate Professor . ... Dr. Sergey Ayukov (asv -at- sai.msu.ru), Research Fellow, Webmaster of the group . ... Joint seminar of Solar Studies Structure Group and Solar Photometry Group . ...

Еще в разделе: (Показать все результаты (>9557) - crydee.sai.msu.ru/ )

• Media types

... file . ... pair_cores: add required option for output file with classes of homology * method blocks_to_homology() of structure.AlignmentMixin was used (see #58) * other output files are now optional * command line option -y corresponds output homology file . ... 4 from repeat_joiner import Interval , RepeatJoiner . ... 10 c1 , c2 , from1 , to1 , from2 , to2 , ori1 , ori2 = line . ... 13 ori1 = True if int ( ori1 ) == 1 else False . ... 15 from1 = int ( from1 ) . ... 17 from2 = int ( from2 ) . ...

Еще в разделе: (Показать все результаты (>31228) - kodomo.fbb.msu.ru/ )

• allpy: ca2cf2377bed utils/pool
• allpy: 7ef0081ffd9c repeats/test.py
• allpy: utils/pool annotate

Электронная библиотека Попечительского совета . ... Eckstein R., Carter G., Watters P. - Using Samba . ... Название: Using Samba . Авторы: Eckstein R., Carter G., Watters P. Аннотация: . Samba is a cross-platform triumph: it turns a Unix or Linux system into a file and print server for network clients using Microsoft Windows on the desktop. ... It's a one-stop-shop to setting up an efficient and secure Samba server . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>18283) - lib.mexmat.ru/ )

• Hausner M., Schwartz J.T. - Lie groups, Lie algebras :: Электронная библиотека
• McCarty B. - Learning Red Hat Linux :: Электронная библиотека попечительского
• Lester A. - MAC OS X Tiger in a Nutshell :: Электронная библиотека

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>206) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• AliComp - GeneBee Alignments Comparison - Advanced
• GeneBee Graphical Alignment - Advanced

This module provides for user authentication using text files. ... Available after Apache 1.3.20] The supplied username and password must be in the AuthUserFile database, and the username must also match the system's name for the owner of the file being requested. ... Available after Apache 1.3.20] The supplied username and password must be in the AuthUserFile database, the name of the group that owns the file must be in the AuthGroupFile database, and the username must be a member of that group. ...

Еще в разделе: (Показать все результаты (>125) - neptun.sai.msu.ru/ )

• The Apache TPF Port
• Source Re-organisation
• Apache suEXEC Support

Next: The active file Up: C-News Previous: Installation . The sys file, located in /usr/lib/news, controls which hierarchies you receive and forward to other sites. ... The sys file contains entries for each site you forward news to, as well as a description of the groups you will accept. ... There has to be an entry for your site in the sys file, too, else you will not receive any articles yourself. ... tells C News to batch only articles from unmod- erated groups. m . ...

Еще в разделе: (Показать все результаты (>751) - itpm.msu.su/ )

• mod_auth - Apache HTTP Server
• dbmmanage - Manage user authentication files in DBM format - Apache HTTP Server
• Using the passwd and group Maps

Using stand-alone SDPfox . ... To add a new specificity group, type in the group name and press "Add" . To change composition of specificity groups, select two groups: first, from which to remove sequences, and second, to which to add sequences. ... For a constructed grouping, it is possible to run SDPgroup, re-randomize grouping or move sequences according to the best weights (see algorithm) under the link 'SDPgroup'. ... These sequences are likely to be re-grouped after SDPgroup is performed. ...

Еще в разделе: (Показать все результаты (>141) - bioinf.fbb.msu.ru/ )

• SDPsite - Algorithm Format requirements
• SDPpred
• Bioinformatics Group of FBB MSU

... This document describes how to setup an ethernet bridge. ... Both of these groups of machines tend to be quite chatty amongst themselves, and the traffic they produce on the network causes collisions for the other machines who are trying to speak to one another. ... Reboot, so you are running the new kernel with bridging in it, and also to make sure that an IP addresses are not bound to the network interfaces. ... Question . ... Can a bridge interface to both 10Mb and 100Mb ethernet segments? ...

Еще в разделе: (Показать все результаты (>733) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - menu/menu.cpp example file
• Apache module mod_auth
• Apache module mod_auth_dbm

PHP Manual . ... This module uses the functions of the bzip2 library by Julian Seward to transparently read and write bzip2 (.bz2) compressed files. ... This module requires bzip2/libbzip2 version >= 1.0.x. This example opens a temporary file and writes a test string to it, then prints out the contents of the file. ... bzclose -- Close a bzip2 file pointer . ... bzerrno -- Returns a bzip2 error number . bzerror -- Returns the bzip2 error number and error string in an array . ... bzclose ...

Еще в разделе: (Показать все результаты (>1576) - oit.cmc.msu.ru/ )

• Using PHP from the command line
• printer_set_option
• print

Joint Scanning Probe Microscopy Group . ... FS Online Manual . ... Nucleic acids . ... Online scanning . ... FemtoScan SPM . FemtoScan Online . SPM database "Scan" . Books in SPM . ... Chair of Polymers . Faculty of Chemistry . Chair of Polymer and Crystal Physics . Faculty of Physics . M.V. Lomonosov Moscow State University . ... spm@genebee.msu.ru . ... Our location at Moscow map . ... Moscow, 119899 Russia . ... SPM Image Gallery . SPM Internet Shop . ...

Еще в разделе: (Показать все результаты (>166) - www.spm.genebee.msu.ru/ )