... Two kinds of devices . Hard disks . ... Disks without filesystems . ... You have to make filesystems on your disks so that files can be stored on them and reserve space for the different parts of your system. ... In fact, one seldom needs to worry about device files at all. ... Having all the device files makes the installation programs simpler, and makes it easier to add new hardware (there is no need to find out the correct parameters for and create the device files for the new device). ...

Еще в разделе: (Показать все результаты (>695) - itpm.msu.su/ )

• Overview of the Directory Tree
• Mapping URLs to Filesystem Locations - Apache HTTP Server
• Configuration Sections - Apache HTTP Server

. The standard system directories are shown below. Each one contains specific types of file. The details may vary between different UNIX systems , but these directories should be common to all. Select one for more information on it. /( root ) | -------------------------------------------------------------- | | | | | | | | /bin /dev /etc /home /lib /tmp /usr kernel file .

Еще в разделе: (Показать все результаты (>643) - comet.sai.msu.ru/ )

• Description of different types of shell
• Creating multiple vi environments
• Removing linked directories that contain links

Network Working Group Request for Comments: 2079 Category: Standards Track M. Smith Netscape Communications January 1997 Definition of an X.500 Attribute Type and an Object Class to Hold Uniform Resource Identifiers (URIs) Status of this Memo This document specifies an Internet standards track protocol for the Internet community, and requests discussion and suggestions for improvements. ... In be helpful to include in the label some indication size of the resource referenced by the URI. ...

Еще в разделе: (Показать все результаты (>51874) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc2079.txt
• Index of /pub/gentoo-portage/app-emacs/typing/
• Index of /pub/gentoo-portage/dev-ros/eigen_stl_containers/

... A meta-data object is a hash of different types of meta-data (keyed on the type, such as 'FIELD' and 'TOPICINFO'). Each entry in the hash is an array, where each entry in the array contains another hash of the key=value pairs, corresponding to a single meta-datum. ... The array entries are keyed with the attribute 'name' which must be in each entry in the array. ... put ObjectMethod put ($type,\%args) . ... get ObjectMethod get ($type,$key) -> \%hash . ... remove ObjectMethod remove ($type,$key) . ...

Еще в разделе: (Показать все результаты (>40865) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% ( vs. 1) - TWiki
• TWikiMetaDotPm - TWiki - TWiki - (printable)
• %TOPICTITLE% (1 vs. 2) - TWiki

PHP Manual . ... This section contains notes and hints specific to installing PHP on Mac OS X Server. ... Mac OS X server install . ... Get the latest distributions of Apache and PHP 2. ... That'll bring the link table up to date. 9. make 10. make install 11. copy and rename the php.ini-dist file to your "bin" directory from your PHP 4 source directory: cp php.ini-dist /usr/local/bin/php.ini or (if your don't have a local directory) cp php.ini-dist /usr/bin/php.ini . ... Unix/Linux installs . ...

Еще в разделе: (Показать все результаты (>1090) - oit.cmc.msu.ru/ )

• Apache module mod_negotiation
• Servers-Netscape and iPlanet
• CURL, Client URL Library Functions

... User installation and start of the CompHEP session . ... The name of received file which you have copied from the CompHEP WWW page should be . ... Unpack this file by . ... If you would like to use Fortran for numerical evaluation you need also a Fortran compiler. The compilation of the CompHEP C source code is launched by the ./create_c command started from the CompHEP root directory. ... The files in the CompHEP root directory will be used only for reading and execution during the user session. ...

Еще в разделе: (Показать все результаты (>1459) - theory.sinp.msu.ru/ )

• Declaration of new index types and indexed objects
• Objects in the expressions for Lagrangian terms
• LanHEP

... Directives | ... Apache HTTP Server Version 2.0 . ... Directives in the configuration files may apply to the entire server, or they may be restricted to apply only to particular directories, files, hosts, or URLs. This document describes how to use configuration section containers or .htaccess files to change the scope of other configuration directives. ... Location> . ... Directives enclosed in a <Directory> section apply to the named filesystem directory and all subdirectories of that directory. ...

Еще в разделе: (Показать все результаты (>2146) - uneex.lorien.cs.msu.su/ )

• Mapping URLs to Filesystem Locations - Apache HTTP Server
• Chapter€а5.€а Getting images into GIMP
• Terms Used to Describe Directives - Apache HTTP Server

This document explains how Apache uses the URL of a request to determine the filesystem location from which to serve a file. ... User Directories . URL Redirection . ... the URL http://www.example.com/docs/dir/file.html will be served from /var/web/dir/file.html . ... The module mod_userdir extends this idea to the web by allowing files under each user's home directory to be accessed using URLs such as the following. http://www.example.com/~user/file.html . ...

Еще в разделе: (Показать все результаты (>126) - neptun.sai.msu.ru/ )

• Apache module mod_negotiation
• Apache module mod_cgi
• How Directory, Location and Files sections work

README for XFree86 on OS/2 : Adding Variables to CONFIG.SYS . ... ETC . Set to an ETC directory. Normally, this is already set to the ETC directory of the TCP/IP code, such as SET ETC=C:\TCPIP\ETC For Warp 4 and later, this may point to the \MPTN\ directory. ... Normally you will set this variable to the same value as the HOSTNAME variable and simply add a :0.0 after it, such as SET DISPLAY=myhost:0.0 Read the X11 man page on the exact meaning of these postfixes and other options. ...

Еще в разделе: (Показать все результаты (>14854) - crydee.sai.msu.ru/ )

• Media types
• Conformance: requirements and recommendations
• crydee.sai.msu.(su,ru) archive: Help

О лаборатории . ... Лаборатория теоретической биофизики . ... ERG group members work with different types of molecules and consequently added new atomtypes into classical OPLS-AA distributed with GROMACS. Now the ERG patch of OPLS-AA force field is published at bitbucket as a repository. ... Нет комментариев " OPLS-AA patch for different types of molecules " . ... OPLS-AA patch for different types of molecules . ... OPLS-AA? in All-atom automatic OPLS-AA topology? ... 2016 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>61) - erg.biophys.msu.ru/ )

• gromacs ERG Research Group: Лаборатория теоретической биофизики
• topology ERG Research Group: Лаборатория теоретической биофизики
• OPLS ERG Research Group: Лаборатория теоретической биофизики

... Constants . Meaning of MPI s defined constants Note that the Fortran types should only be used in Fortran programs, and the C types should only be used in C programs. For example, it is in error to use MPI_INT for a Fortran INTEGER. Datatypes are of type MPI_Datatype in C and of tyep INTEGER in Fortran. ... INTEGER . ... return the maximum . ... Any error return . ... Error handler that returns error codes (as value of MPI routine in C and through last argument in Fortran) . ... Центры . ...

Еще в разделе: (Показать все результаты (>775) - www.parallel.ru/ )

• Derived datatypes | PARALLEL.RU - Информационно-аналитический центр по
• Special features of different systems | PARALLEL.RU -
• Heterogeneous networks of multicomputers and the ch_nexus device | PARALLEL.RU

The Trac Environment = Trac uses a directory structure and a database for storing project data. ... Creating an Environment == A new Trac environment is created using [wiki:TracAdmin trac-admin]: {{{ $ trac-admin /path/to/myproject initenv }}} [wiki:TracAdmin trac-admin] will ask you for the name of the project, the database connection string (explained below), and the type and path to your source code repository. ... LATIN1 encoding causes errors trac's use of unicode in trac. ...

Еще в разделе: (Показать все результаты (>3469) - kodomo.cmm.msu.ru/ )

• TracEnvironment тАУ Tanchiki
• Help: archive
• WikiProcessors тАУ Tanchiki

This module is contained in the mod_expires.c file, and is not compiled in by default. It provides for the generation of Expires headers according to user-specified criteria. ... The expiration date can set to be relative to either the time the source file was last modified, or to the time of the client access. ... ExpiresByType . ExpiresDefault . ... Module: mod_expires . This directive enables or disables the generation of the Expires header for the document realm in question. ...

Еще в разделе: (Показать все результаты (>870) - rtm-cs.sinp.msu.ru/ )

• Supported Data Types
• How Directory, Location and Files sections work
• Apache module mod_cgi

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>168) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help

... The numbers of three types of compact binaries containing accreting NSs and BHs, which are most interesting from the point of view of their observational appearances, have been calculated as a function of time: i) X-ray transient source containing a NS in an eccentric orbit around a main sequence Be-star (the observed prototype: A0535+26), ii) BH The evolution of the selected types of X-ray binaries during the first 10 million years after the starburst onset is presented in Fig. ...

Еще в разделе: (Показать все результаты (>642) - xray.sai.msu.ru/ )

• Mixing types of E-P-A binary systems with non-zero orbital eccentricity
• Seminars
• Be/X-ray binaries and candidates

... help . find changesets by author, revision, files, or words in the commit message hg archive [OPTION].. ... Valid types are: "files" a directory full of files (default) "tar" tar archive, uncompressed "tbz2" tar archive, compressed using bzip2 "tgz" tar archive, compressed using gzip "uzip" zip archive, uncompressed "zip" zip archive, compressed using deflate The exact name of the destination archive or directory is given using a format string; see "hg help export" for details. ...

Еще в разделе: (Показать все результаты (>45076) - kodomo.fbb.msu.ru/ )

• allpy: 9c00d065c054 README.devel
• allpy: e83572fff43f README.devel
• Help: filesets

SVETKA, a program for analysis of different alignments . Back to the help page . ... Such a feature can look like " Leucine in the position 362 of the alignment of the entire family " and can, in many cases, be a "decision rule" to distinguish sequences from two sides of a tree branch. ... Comparing the alignment with an input tree (the tree may be entered by the user or reconstructed with the WPGMA algorithm), the program detects supporting positions of the alignment for every branch the tree. ...

Еще в разделе: (Показать все результаты (>3549) - monkey.belozersky.msu.ru/ )

• PDB entries containing domains of the family "DNA polymerase type B, organellar
• PDB entries containing domains of the family "Zinc finger, C2H2 type"
• PDB entries containing domains of the family "Zinc finger, C4 type (two

... Elliptical Galaxy M87 . ... Credit: Canada-France-Hawaii Telescope , J.-C. Cuillandre ( CFHT ), Coelum Explanation: Elliptical galaxy M87 is a type of galaxy that looks much different than our own Milky Way Galaxy. Even for an elliptical galaxy , though, M87 is peculiar. ... Публикации с ключевыми словами: Elliptical Galaxy - M87 - эллиптическая галактика . Публикации со словами: Elliptical Galaxy - M87 - эллиптическая галактика . ... Далекие галактики . ... Эллиптическая галактика M87 . ...

Еще в разделе: (Показать все результаты (>21162) - www.astronet.ru/ )

• Elliptical Galaxy M87
• Journal "Peremennye Zvezdy"
• Short Gamma Ray Bursts Localized

A very important stage in a story of formation of any new science is the shift from discussion of situation which are possible but do not occur in practice due to some reason to recognition of real phenomena of interest. ... We suggest to consider computer viruses as this new specific form of life which is coming in the contact with our form of life. ... Computer life has been created by human being, the role of independent evolution of computer viruses seems to be still negligible. ...

Еще в разделе: (Показать все результаты (>425) - lnfm1.sai.msu.ru/ )

• IDL programs
• Data bases of Natural Satellites. Documentation. Structure

... Next: It(Z) tab (STM mode), Up: Scan parameters Previous: Scan parameters Contents Index . On this tab user can set scan parameters corresponding to surface scanning Z(X,Y). ... Scanning mode can be set using falling list that is in upper part of the tab window . ... Steps/lines -- number of points in a scan line and number of lines in surface image. ... On the Litography tab user can choose Mask image , litography mode and parameters for probe-sample interaction during lithography process. ...

Еще в разделе: (Показать все результаты (>148) - www.spm.genebee.msu.ru/ )

• Files Quick Viewing
• Slide Show
• Put a mark