... Each day a different image or photograph of our fascinating universe is featured, along with a brief explanation written by a professional astronomer. 2011 January 17 . Night and Day above Almost Planet Sounio . ... Explanation: Has a new planet been discovered? ... Contrastingly, images taken during the day compose the bottom of the image, with the Sun being captured once every 15 minutes. ... About APOD | ... NASA Official: Phillip Newman Specific rights apply . ...

Еще в разделе: (Показать все результаты (>9437) - www.sai.msu.su/ )

• Astronomy Picture of the Day
• APOD: 2010 February 9 - Night Launch of the Space Shuttle Endeavour
• APOD: 2003 August 7 - Palomar at Night

... Астронет | Картинка дня | ... планета Астронет | ... Астрономическая картинка дня . ... Около равноденствия магнитное поле Земли ориентировано так, что создаются благоприятные условия для взаимодействия с солнечным ветром, которое и вызывает прекрасное северное сияние. ... Полярные сияния и магнитосфера Юпитера . ... Слегка сжатое магнитное поле словно через воронку несет заряженные частицы к полюсам Юпитера, опуская их прямо в его атмосферу. ... Туманность Пузырь крупным планом . ...

Еще в разделе: (Показать все результаты (>74783) - www.astronet.ru/ )

• Europe at Night
• XWare > APOD
• Night and Day above Almost Planet Sounio

.

Еще в разделе: (Показать все результаты (>12518) - crydee.sai.msu.ru/ )

• RUSH Lyrics

... May 1, 1996 . Comet Hyakutake and a Cactus . ... Today Comet Hyakutake reaches its closest approach to the Sun . Comet Hyakutake is now at its intrinsic brightest, but because of its distance from the Earth , it will appear less bright to us than it did during its closest approach to the Earth in late March. ... Latest Comet Hyakutake images: APOD Hyakutake Archive , JPL , Fayetteville Observer-Times , NASA's Night of the Comet , ICSTARS , Jerry Lodriguss , ScienceWeb , Crni Vrh Obs. ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: November 12, 1996 - Comet Hale-Bopp Passes M14
• APOD: 2001 January 18 - 2001: A Total Lunar Eclipse
• APOD: 2000 November 8 - October Skylights

Use of humates to remediate polluted environments: . ... Picture gallery of the events . ... Use of different adsorbents (peats, sapropels, ceolites) in remediation technologies . ... Bezuglova, O.S. Use of humates and humate-enzyme complexes for the detoxification of soils contaminated with heavy metals. ... Coffee break . 11:00-12:00 . ... Theory and practice of humates use for remediation of polluted environments . ... Round table discussion: Working groups . ...

Еще в разделе: (Показать все результаты (>146) - mgumus.chem.msu.ru/ )

• Picture gallery of the participants and guests

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>114) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• TreeTop - Phylogenetic Tree prediction

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... When detection of the change-points in alpha band power was performed as in the previous subsection, more than one change-point per second was obtained in average. ... The hypothesis of the hierarchy of EEG segmental descriptions (Kaplan 1998) (see subsection 7.3.2) is a theoretical reason for introducing the adjustment of the change-point detection probability. ...

Еще в разделе: (Показать все результаты (>52) - brain.bio.msu.ru/ )

This example shows how to make, store to file, and read a picture as a set of drawing commands. ... This example ** program may be used, distributed and modified without limitation. ** *****************************************************************************/ # include ctype.h # include qapplication.h # include qpainter.h # include qpicture.h # include qpixmap.h # include qwidget.h # include qmessagebox.h # include qfile.h void paintCar( QPainter *p ) // ...

Еще в разделе: (Показать все результаты (>471) - rtm-cs.sinp.msu.ru/ )

• Pictures of Most Widgets
• Qt Toolkit - QPicture Class

Chernobyl accident which took place in the night since 25 till 26, April is the most considerable nuclear accident of our days. ... The head of the Expedition – head of laboratory I.N. Ryabov, deputy head – I.A. Ryabtsev. ... Preprints “Scientific reports”. ... Scientific leader of Complex Radioecological Expedition academician V.E. Sokolov, head of expedition I.N. Ryabov, dbs N.V. Kulikov (Chernobyl, 1987) . ... Head of Complex Radioecological Expedition I.N. Ryabov and famous radiobiologist Zh.A.. ...

Еще в разделе: (Показать все результаты (>7082) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: provide the motion picture to
• Экологический Форум - Фундаментальная Экология: give the motion picture to the
• Экологический Форум - Фундаментальная Экология: give the motion picture to a

Cloud cover and water vapor observed at Oma site,Tibet W ang Hong-shuai (National Astronomical Observatories of China) Kislovodsk 8.10.2010 Wang Hongshuai ­ Kislovodsk ­ Oct.2010 2 2008.11 Oma Site 40 m CT 2 tow er 4.5 m antenna Satellite communication w eather station 10m tow er SBIG seeing m onitor DIMM seeing dome MIR cloud m onitor R en ew al p o w er supply Wang Hongshuai ­ Kislovodsk ­ Oct.2010 3 PWV<0.5 5 .0 % 1 0 .1 % 8 .1 % Percent. ... 05 8.3% Percent . ...

Еще в разделе: (Показать все результаты (>25) - site2010.sai.msu.ru/ )

• Methods and instruments to measure/monitor major site properties

... This is my main interest in linguistics that I have been pursuing for a number of years. ... Spoken language . Present-day linguistics is primarily oriented towards written language. ... I am personally interested in the latter kind of research since I prefer to use first-hand knowledge rather that crucially rely on how other people interpret languages (or still other people?s writings). ... This is one of the major languages of Russia spoken by dozens of thousands of people. ...

Еще в разделе: (Показать все результаты (>317) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/main/people/kibrik-aa/ongoing_projects.html

Электронная библиотека Попечительского совета . ... Tuxworth N. - Clothes: A Very First Picture Book . ... Название: Clothes: A Very First Picture Book . Автор: Tuxworth N. Аннотация: . Children dress up and try on all different sorts of clothes in the VERY FIRST PICTURE BOOKS series. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>6555) - lib.mexmat.ru/ )

• Nemoodar S., Sandy J. - Orthodontics: Picture Test Atlas :: Электронная
• Huang T.S., Andrews H.C. - Picture Processing and Digital Filtering ::
• Поиск книг, содержащих picture (окружение) :: Электронная библиотека

... About lab . ... Conference "GraphiCon" . Online Journal "Computer graphics and multimedia" (in russian) . ... Methodology of stereoscopic motion picture quality assessment . ... Conference Paper . ... Conference Name . Stereoscopic Displays and Applications XXIV, Proc. of SPIE-IS&T Electronic Imaging, SPIE . ... http://compression.ru/video/vqmt3d/papers/Methodology%20for%20Stereoscopic%20Motion-picture%20Quality%20Assessment.pdf . ...

Еще в разделе: (Показать все результаты (>162) - graphics.cs.msu.ru/ )

• Methodology of stereoscopic motion picture quality assessment | Лаборатория

. The HTMLPAGE uses the client-side imagemap construction.Click the any picture to see full-size and full-color images. If your client don't support client-side imagemap, You can append the filename (under each image) to the URL location Description: . Not available yet ... Best Regards, Pavel Plechov

Еще в разделе: (Показать все результаты (>642) - geo.web.ru/ )

• Index of Kamchatka Pictures
• dscn1156.jpg
• dscn0293.jpg

ALBUM: baby @SONG: DESIRE The sun Blowing the moon away Lights me up for One more day The streets are naked In the morning sun The night lifts behind me I run and run Morning heat Puts a thin film of sweat ... breakfast Trying to impress the barman with a fresh voice When I ask for the bill The sun Blowing the moon away Lights me up for One more day The streets are naked In the morning sun The night lifts behind me I run and run Desire Desire for the unknown eyes Desire ...

Еще в разделе: (Показать все результаты (>337) - xray.sai.msu.ru/ )

• roma-2000
• Pictures
• Picture for Zelmanov Seminar on Gravitation and Cosmology

... Главная -> Фильмы -> The Picture of Dorian Gray . ... Фильмы . ... The Picture of Dorian Gray . ... George Sanders . ... Harry Adams . ... Harry Allen . Jimmy Aubrey . ... George Broughton . ... Jimmy Conlin . ... Herbert Evans . Rex Evans . ... Dorothy Ford . Lloyd Ford . ...

Еще в разделе: (Показать все результаты (>4521) - kinfo.ru/ )

• Team Picture - Фильмы - Kinfo.ru
• Picture Perfect - Фильмы - Kinfo.ru
• The Big Picture - Фильмы - Kinfo.ru

... Adiantaceae . ... Aceraceae . Actinidiaceae . ... Asteraceae ( Compositae , nom. alt.) ... Brassicaceae ( Cruciferae , nom. alt.) ... Fabaceae s. l. ( Leguminosae , nom. alt.) ... Lamiaceae ( Labiatae , nom. alt.) ... Umbelliferae ( Apiaceae , nom. alter.) ... Liliaceae s. l. Poaceae ( Gramineae , nom. alt.) ... Phone/fax: 7 (095) 939-2777 . e-mail: alnus@herba.msu.ru . ... Images of living plants . ...

Еще в разделе: (Показать все результаты (>195) - herba.msu.ru/ )

• Pictures of the invertebrates
• Materials of A. Shipunov

... Photos and pictures at Archives.gov . ... Escher Art Collection . ... International Art Science . ... Earth Observatory image news index . ... Moscow: administration, culture, education.. ... Fluid Dynamics Pictures of the Week Collection . Sites With Pictures and Movies of Fluids also you can look at the interesting High-Speed Photographs . ... Moscow day by day . ... old maps of Moscow . ... Crimea . Crimea MAP (clickable) . Surfing Santa Cruz . On-line pictures: . ...

Еще в разделе: (Показать все результаты (>12) - astrometric.sai.msu.ru/ )

... Figure 6.1: Example of the CompHEP menu . Figure 6.2: Example of the Fortran menu . Figure 6.3: Example of the CompHEP tables . Figure 6.4: Example of the CompHEP diagram images . Figure 6.5: Menu scheme for the symbolic session . Figure 6.6: Example of the process input . Figure 6.7: Example of the plot image . Figure 6.8: Menu scheme for the numerical session . ... Figure 6.10: Plot for a 2- 2 process . Figure 6.11: Example of pseudo-graphic diagram image . ...

Еще в разделе: (Показать все результаты (>1879) - theory.sinp.msu.ru/ )

• QFTHEP'2000-Pictures
• staff:kryukov:funny [THEP]

Борис Михайлович Болотовский (ФИАН) . ... автор книги "Оливер Хевисайд" (см. сайт изд. ... Оливер Хевисайд (1850 - 1925), закончил только неполную среднюю школу, дальнейшие знания получил самостоятельно, путем самообразования. ... Предсказал что в верхних слоях атмосферы существует слой (слой Хевисайда), отражающий электромагнитные волны. ... Аудио запись доклада Б.М. Болотовского ( 58 мин, mp3, 80MB ). ... Б.М. Болотовский начал свой доклад . ... Продолжение доклада. ...

Еще в разделе: (Показать все результаты (>9) - lve.sinp.msu.ru/ )

• All Gell-Mann_Sep25_2007 pictures
• Lubyanka_after_Mar29_2010 pictures
• All Piter_Oct-2010 pictures