This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>119) - neptun.sai.msu.ru/ )

• Apache module mod_vhost_alias
• Apache module mod_imap
• Apache module mod_auth_anon.c

... To go through each file in the current directory and compare it with the same filename in another directory: #!/bin/sh # compare files to same file in directory "old" for i in * do echo $i: cmp $i old/$i echo done . ... Some examples of command substitution in for loops: #!/bin/sh # do something for all files in current # directory according to time modified for i in `ls -t` do ... done # do something for all non-fred files. for i in `cat filelist | ...

Еще в разделе: (Показать все результаты (>569) - comet.sai.msu.ru/ )

• Examples of inserting the contents of another file
• Example of logging in to another account
• Examples of copying files from another host

Modules | ... Apache HTTP Server Version 2.0 . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... If you link it into your server, enable the "example-handler" handler for a location, and then browse to that location, you will see a display of some of the tracing the example module did as the various callbacks were made. ... Using the mod_example Module . ...

Еще в разделе: (Показать все результаты (>616) - itpm.msu.su/ )

• Another Example
• mod_dav - Apache HTTP Server
• mod_auth_anon - Apache HTTP Server

This page demonstrates how to setup a flat calendar. ... The code in this page uses a helper function defined in "calendar-setup.js". ... The positioning of the DIV that contains the calendar is entirely your job. For instance, the "calendar-container" DIV from this page has the following style: "float: right; margin-left: 1em; margin-bottom: 1em". ... You can find the full description of the Calendar.setup() function in the calendar documenation . ...

Еще в разделе: (Показать все результаты (>41624) - dualopt1.cmm.msu.ru/ )

• BehaviourContrib - TWiki - TWiki - (printable)
• BehaviourContrib - TWiki - TWiki
• %TOPICTITLE% ( vs. 1) - TWiki

Channel ops are one of the most powerful and simple tools available to you with the GIMP. ... Channel ops are operations that typically involve two images. Each channel operation compares and does some sort of manipulation based on the pixels in two images. ... Add takes two images, and adds the RGB or greyscale values of the pixels. ... If you have a completely black canvas, all the values are zero. ... This channel operation compares two images and results in the darkest values from each image. ...

Еще в разделе: (Показать все результаты (>5621) - www.sai.msu.su/ )

• CoolType.pagemaker - Wrapping Text Around Text
• GIMP Plug-In Examples
• SAL- Programming - Languages Compilers - kForth

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>26) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search
• ConClus

This contrib packages the third-party Behaviour Javascript event library, written by Ben Nolan. ... And then use css selectors to select that element and add javascript functions to it. var myrules = { '#example li' : function(el){ el.onclick = function(){ this.parentNode.removeChild(this); } } }; Behaviour.register(myrules); . Include the javascript file: . ... Or use nested identifiers: var myrules = { '.menu li a' : function(element) { element.onclick = function() { // code here } } }; . ...

Еще в разделе: (Показать все результаты (>7959) - wiki.cmc.msu.ru/ )

• JQueryLiveQuery < System < Foswiki
• JQueryButton < System < Foswiki

. Album : Фотоальбом Сергея Аюкова :: Travels to distant places and countries :: 1997/08 Japan (Kyoto, Nara) :: 17/08 Kyoto streets. Maruyama park . Up . << Prev . Another fine example of typical roof. Still don't know exactly what it was made of. Next >> . Created with the tool album tool from David Ljung's MarginalHacks on Wed Jun 5 20:38:35 2013 .

Еще в разделе: (Показать все результаты (>6155) - crydee.sai.msu.ru/ )

• Image: Another example of near-house decorations
• The new precision concept
• Specifications

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6985) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Alignment example

This module is contained in the modules/mod_example.c file, and is not compiled in by default. It illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... cp src/modules/example/* src/modules/ mymodule . ... Example . ...

Еще в разделе: (Показать все результаты (>752) - rtm-cs.sinp.msu.ru/ )

• Running the example
• Qt Toolkit - QBoxLayout Class
• Apache module mod_alias

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>336) - monkey.belozersky.msu.ru/ )

• SDPpred
• Example of supporting positions
• DNA/RNA-Protein structures

The Trac Repository Browser = [[TracGuideToc]] The Trac repository browser can be used to browse specific revisions of directories and files stored in the repositories associated with the Trac environment. ''(since 0.12)'': At the top-level of the repository browser is the '''Repository Index''', listing all the configured repositories. ... It's also possible to browse directories or files as they were in history, at any given repository revision. ...

Еще в разделе: (Показать все результаты (>4385) - kodomo.cmm.msu.ru/ )

• WikiProcessors тАУ Tanchiki
• examples.zip тАУ Cyclyc Cell Automata
• TracBrowser (diff) тАУ Tanchiki

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>14) - storage.bioinf.fbb.msu.ru/ )

We have prepared some summation programs for working with Reduce output. ... 1 in $COMPHEP/test/sum.red $ % loading the summation package in symb1.red $ % reading contributions of diagrams sum; % writing the answer (32*ee**4*(2* p1.p2 **4-4* p1.p2 **3* p1.p3 +3* p1.p2 **2* p1.p3 **2-2* p1.p2 **2* p1.p3 *me**2-p1.p2* p1.p3 **3 + 2* p1.p2 * p1.p3 **2*me**2 + p1.p3 **2*me**4)) /(propden(-p1-p2,me,0)**2*propden(p2-p3,me,0)**2)$ %2 in $COMPHEP/test/sum2pole.red $ % loading the ...

Еще в разделе: (Показать все результаты (>12789) - theory.sinp.msu.ru/ )

• Phase space functions
• Menu 1.
• fc3:dokuwiki:example - Old revisions [THEP]

PHP Manual . ... Variables . ... When a form is submitted to a PHP script, any variables from that form will be automatically made available to the script by PHP. ... Simple form variable . form action="foo.php" method="post"> Name: <input type="text" name="username"><br> <input type="submit"> </form> . ... The experienced may note that the actual variable names sent by the browser contains a period rather than an underscore, but PHP converts the period to an underscore automatically. ...

Еще в разделе: (Показать все результаты (>1539) - oit.cmc.msu.ru/ )

• Hiding PHP
• Declaring Exported Functions
• The Apache TPF Port

Modules | ... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Modules . ... Allows "anonymous" user access to authenticated areas . ... This module does access control in a manner similar to anonymous-ftp sites; i.e. have a 'magic' user id 'anonymous' and the email address as a password. ... When set On the 'password' entered is checked for at least one '@' and a '.' to encourage users to enter valid email addresses (see the above Anonymous_LogEmail ). ...

Еще в разделе: (Показать все результаты (>936) - uneex.lorien.cs.msu.su/ )

• mod_version - Apache HTTP Server
• mod_dav - Apache HTTP Server
• mod_negotiation - Apache HTTP Server

... Write {{ note text }} anywhere in a topic. ... FOOTNOTE{LIST="Web.Topic"}% will be replaced by the notes from an %INCLUDE% ed page. ... Tim Berners-Lee{{Tim Berners-Lee is now director of the World Wide Web Consortium, and Professor of Computer Science at Southampton ECS.}} invented the World Wide Web. ... Tim Berners-Lee (1) invented the World Wide Web. ... Notes 1 : Tim Berners-Lee is now director of the World Wide Web Consortium, and Professor of Computer Science at Southampton ECS. ...

Еще в разделе: (Показать все результаты (>2191) - wiki.cs.msu.ru/ )

• JQueryUIDialog < System < Foswiki
• SafeWikiPlugin < System < Foswiki
• YahooUserInterfaceContrib < System < Foswiki

grdreformat - Converting between different grdfile formats. grdreformat ingrdfile [= id [/ scale / offset [/ nanvalue ]]] outgrdfile [= id [/ scale / offset [/ nanvalue ]]] [ -R west / east / south / north [ r ] ] [ -V ] grdreformat reads a grdfile in one format and writes it out using another format. As an option the user may select a subset of the data to be written and to specify scaling, translation, and nan-value. ingrdfile The grdfile to be read. ...

Еще в разделе: (Показать все результаты (>423) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~polar/xmgr/sets.html
• http://xray.sai.msu.ru/~ivan/gmt/man/pstext.html
• http://xray.sai.msu.ru/~polar/xmgr/status.html

... MPI: A Message-Passing Interface Standard . ... The Message Passing Interface Forum (MPIF), with participation from over 40 organizations, has been meeting since January 1993 to discuss and define a set of library interface standards for message passing. ... The goal of the Message Passing Interface, simply stated, is to develop a widely used standard for writing message-passing programs. ... Index to MPI Standard . ... Marc Snir, William Gropp, Ewing Lusk, Point-to-Point Communications . ... Центры...

Еще в разделе: (Показать все результаты (>501) - www.parallel.ru/ )

• Client/Server Examples | PARALLEL.RU - Информационно-аналитический центр по
• Examples | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Library Example #2 | PARALLEL.RU - Информационно-аналитический центр по

GDE alignment format is one of standard alignment formats. A popular program for sequence alignment, Clustal, for example, can save alignment in this format. In this format, all letters indicating amino acids are in lower case, gaps are indicated by dashes. Sequences are placed one after another, name of each sequence is placed onto a separate line and begins with ‘%’. The sequence is placed afterwards beginning on the next line and may be broken into several lines. ...

Еще в разделе: (Показать все результаты (>143) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPsite - Algorithm Format requirements
• User's guide