... About lab . ... Video matting refers to a problem of accurate decomposition of given video sequence to background layer, foreground layer and transparency map. The VideoMatting project is the first online benchmark of video matting methods. ... Background . ... Ground-truth alpha (transparency map) . ... To obtain trimaps, we perform morphological operations on ground-truth (GT) alpha mattes and composites by placing ground-truth foregrounds over new backgrounds. ... multiline equation . ...

Еще в разделе: (Показать все результаты (>250) - graphics.cs.msu.ru/ )

... Results Comparison with FASTA archaean genomes. ... But each of these programs has some signicant Table 1: Numb er of found alignments with E-value less than given Program FASTA Nhunt Run time 5.5 1.4 Example alignment : Query: ctgtttaccaggtcaggtccggaaggaagcagccaaggcagatgacgcgt aaaaaaaa||||aa|||||a|a|aaa|||a||aa|| |||||||aa||a|||aa||a| Sbjct: ctgtgaaccagcttatcgccgcaatcaaacagccaaatcatatgcagcat Identity = 33/50 (66%) Strand: Plus/Minus Alignment features without scoring ...

Еще в разделе: (Показать все результаты (>28) - mouse.genebee.msu.ru/ )

• Comparison of protein phylogeny reconstruction methods
• Nhunt: program for nucleic acid sequence similarity search

Astronomy Picture of the Day . X-ray Transit of Mercury . ... 2.07.1998 . ... Credit: ISAS , Yohkoh Project Explanation: This sequence of false color X-ray images captures a rare event - the passage or transit of planet Mercury in front of the Sun. Mercury's small disk is silhouetted against the bright background of X-rays from the hot Solar Corona . ... July 1998 . ... Publications with keywords: Sun - Mercury - transit - X-ray . Publications with words: Sun - Mercury - transit - X-ray . ...

Еще в разделе: (Показать все результаты (>12034) - www.astronet.ru/ )

• X ray Transit of Mercury
• Астронет > X-ray Transit of Mercury
• Journal "Peremennye Zvezdy"

... Each day a different image or photograph of our fascinating universe is featured, along with a brief explanation written by a professional astronomer. 2012 November 16 . Moon Shadow Sequence . Image Credit Copyright : Ben Cooper ( Launch Photography ) . Explanation: On the morning of November 14, the Moon's umbral shadow tracked across northern Australia before heading into the southern Pacific. ... About APOD | ... NASA Official: Phillip Newman Specific rights apply . ...

Еще в разделе: (Показать все результаты (>3230) - www.sai.msu.su/ )

• APOD: November 6, 1999 - X ray Transit of Mercury
• APOD: July 2, 1998 - X-ray Transit of Mercury
• SAL- Other Scientific Fields - Chemistry, Biology Related - Evalign

The Department of Talented Youth Affairs and Professional Orientation . ... Olympiads . ... All-army olimpiad . ... Olympiad for School Pupils . ... Olympiad for school pupils was held in 2005 under the motto ?Via scientiarum?, which means ?The way to the knowledge? in Latin. ... The 46 th Mendeleev International Olympiad in Chemistry for School Pupils was held in Kazakhstan in the 2011-2012 school year. ... 2016 - The Department of Talented Youth Affairs and Professional Orientation ...

Еще в разделе: (Показать все результаты (>49) - talant.msu.ru/ )

• For participants of ?Lomonosov? Olympiad | The Department of Talented Youth

Электронная библиотека Попечительского совета . ... Green J.A. - Sequences and series . ... Название: Sequences and series . Автор: Green J.A. Язык: . ... Binomial series 49 69 71 . Binomial series, theorem 25 . Bounded sequence 15 . ... Cosine series 50 . ... Differentiation of series 70 . ... Exponential series 48 52 62 72 . ... Finite sequence, series 24 . ... Infinite sequence, series 25 . ... Power series 47 . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>15040) - lib.mexmat.ru/ )

• Green J.A. - Sequences And Series :: Электронная библиотека попечительского
• Knopp K., Bagemihl F. - Infinite Sequences and Series :: Электронная библиотека
• Percus J.K. - Mathematics of genome analysis :: Электронная библиотека

... line source . ... 6 def __init__ ( self , * args , ** kw ): . ... init__ ( self , * args , ** kw ) . ... 12 def attach ( self , widget ): . ... 15 widget [ command ] = lambda * args , ** kw : self . ... 17 def _command ( self , * args , ** kw ): . ... 24 def _set ( self , sender , * args , ** kw ): . ... 41 def tag_clear ( self , tag ): . ... 47 def insert ( self , * args , ** kw ): . ... insert ( self , * args , ** kw ) . ... 53 def _select ( self , ev ): . ... 79 names . ... 80 sequences . ...

Еще в разделе: (Показать все результаты (>28591) - kodomo.fbb.msu.ru/ )

• allpy: ee2c10aa74b8 sandbox/ttk.py
• allpy: 835efa2a8c71 sandbox/ttk.py
• allpy: cf15f7653423 test/usecase1.py

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>285) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/44.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/78.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/38.pdf

... Другие названия журнала: BIOCHIMICA ET BIOPHYSICA ACTA-GENERAL SUBJECTS , Biochimica et biophysica acta. General Subject , Biochimica et biophysica acta. General Subjects . ... Aisina R. , Mukhametova L. , Varfolomeyev S. в журнале Biochimica et Biophysica Acta - General Subjects , издательство Elsevier BV (Netherlands) , том 1860, с. 629-635 DOI . ... Izumrudov Vladimir A. в журнале Biochimica et Biophysica Acta - General Subjects , издательство Elsevier BV (Netherlands) , том 1830, ? ...

Еще в разделе: (Показать все результаты (>1908) - istina.msu.ru/ )

• DNA sequence : the journal of DNA sequencing and mapping - журнал | ИСТИНА -
• Dunmire B. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... Unless in many other approaches to the analysis of different signal coupling, the information entering the analysis of synchronization in our approach is explicitly represented in the form of elementary, instantaneous events (the change-points). ... Hence the use of correlation/coherency estimates in parallel with change-point analysis seems to be quite rational. ...

Еще в разделе: (Показать все результаты (>61) - brain.bio.msu.ru/ )

• Change-points at different levels of the hierarchy of EEG segmental...
• Change-points in multi-channel EEG

Galina K. Vasilyeva , PhD, senior researcher at the Institute of Physical Chemical and Biological Problems in Soil Science, Russian Academy of Sciences (IPBPSS RAS), head of group of soil bioremediation. Tel. (of.) 096) 773-3830. ... Participant of Russian-American exchange programs: 1. ... Nadezhda D. Anan'eva , PhD, Chief of the Laboratory of soil microbiology at the Institute of Physical Chemical and Biological Problems in Soil Science, Russian Academy of Sciences (IPBPSS RAS). ...

Еще в разделе: (Показать все результаты (>100) - www.prof.msu.ru/ )

• A Unique Opportunity for Young Americans and Russians to Volunteer Abroad!
• 2004 FULBRIGHT AMERICAN STUDIES INSTITUTES
• Message to Fulbright and HHH alumni and participants

BLASTP 2.2.15 [Oct-15-2006] # Query: AALD01000003_2 [1802 - 2383] AALD01000003.1 Yersinia mollaretii ATCC 43969 1013, whole genome shotgun sequence. ... Database: eco # Fields: Query id, Subject id, % identity, alignment length, mismatches, gap openings, q. start, q. end, s. start, s. end, e-value, bit score AALD01000003_19 RECN_ECOLI 78.08 219 48 0 37 255 1 219 3e-95 341 ...

Еще в разделе: (Показать все результаты (>3813) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~molotok/Term3/blastp1
• http://kodomo.cmm.msu.ru/~lesiad/Term3/out.txt
• http://kodomo.cmm.msu.ru/~svetra/Term3/nahodki.txt

... 3.0.4 - 3.0.18 only, PHP 4 >= 4.0.0) imap_fetch_overview -- Read an overview of the information in the headers of the given message . array imap_fetch_overview ( int imap_stream, string sequence [, int flags]) . ... mbox = imap_open("{your.imap.host:143}","username","password") or die("can't connect: ".imap_last_error()); $overview = imap_fetch_overview($mbox,"2,4:6",0); if(is_array($overview)) { reset($overview); while( list($key,$val) = each($overview)) { print $val->msgno . ... val->subject . ...

Еще в разделе: (Показать все результаты (>233) - oit.cmc.msu.ru/ )

• Pattern Modifiers
• preg_replace
• preg_match

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>208) - www.genebee.msu.ru/ )

• Bioinformatics portal, Moscow State University
• AliComp - GeneBee Alignments Comparison - Advanced
• GeneBee

S .. ... a database of structures of DNA-protein and RNA-protein complexes. ... a program for finding hydrophobic clusters in 3D structures of macromolecules . ... search of conserved hydrophobic clusters in aligned 3D structures of protein families . ... a program for analysis of multiple alignments . ... a program for automatic detection of aligned blocks in a multiple protein alignment. ... a program for detection of aligned blocks in a multiple alignment of sequences of PDB chains. ...

Еще в разделе: (Показать все результаты (>1239) - monkey.belozersky.msu.ru/ )

• Inquiry information || Rule of four sequences
• ETS_all_contacts alignment
• S publications

... Policies to promote environmentally sound production methods; conservation and protection of natural resources; . ... Farm price policy and reduction of agricultural subsidies; . ... Credit; consumer credit; production credit; credit agencies; . Problems related to extension of short-term production credits; medium-term and long-term credits; investment and credit policies: demand and supply; economics, institutions; agricultural debt restructuring; mortgage systems; . ... Markets and trade; . ...

Еще в разделе: (Показать все результаты (>184) - www.fadr.msu.ru/ )

• THE POST-SIMPOSIUM EXCURSION (July 31 - August 7,1998)
• Strategy for project-based activities
• SPECIAL ISSUE OF CATENA «RECONSTRUCTION AND CLIMATIC IMPLICATIONS OF PALEOSOLS»

... Observational Zoo of Binaries with Compact Stars . Evolutionary Scenarios of Binary Systems . ... Evolution of Magnetic Rotators . ... Mixing types of E-P-A binary systems with non-zero orbital . ... Binary Pulsar Diversity and High Neutron Star Birth Velocity . ... Ejectors in Massive Binary Systems . ... Other Candidates for Ejecting Stars in Binary Systems . ... Cosmic Rays and Evolution of Binary . ... Sky in Gravitational Waves . ... Gravitational Waves from Coalescing Compact Binary Stars . ...

Еще в разделе: (Показать все результаты (>420) - xray.sai.msu.ru/ )

• No Title
• Gravitational Wave Background from Individual Galaxies
• Post main sequence stars (stage II)

... subject on semigroups of operators and evolution equations: . ... 3 rd   International Workshop-Conference on Evolution Equations, Control Theory and   Biomathematics, Han-sur-Lesse, Belgium(1991); . ... Evolution Equations Conference, Glasgow, UK (July, 1994); . ... Fifth International Conference on Evolution Equations and Their Applications to Technology, Hiroshima, Japan (October, 1996); . ... International Conference on Differential Equations and Dynamical Systems, Suzdal, Russia ( July, 2002); ...

Еще в разделе: (Показать все результаты (>127) - srcc.msu.ru/ )

Schedule : Modern Group Analysis (MOGRAN 9) . ... Ibragimov N.H. Chair's opening remarks to the participants of the 9th International Conference on Modern Group Analysis (MOGRAN 9) . ... Break . ... Khabirov S. V. The Differential-Invariant Submodels . ... Maluleke G. Optimal System and Group Invariant Solutions for a Nonlinear Wave Equation . ... Yemelyanova I. S. On Applications of Group Analysis of Differential Equations in Analytical Dynamics. ...

Еще в разделе: (Показать все результаты (>309) - acs366.phys.msu.su/ )

• Abstract

Occurrence of the markers -ld- and -lc- in Kalmyk 1 In the Kalmyk language (Mongoli, Altaic) the meaning of plurality of participants can be expressed by verbal suffixes -ld- and -lc-. ... As the meaning of plurality and the additional meaning are often expressed by some other means (plural form of subject, reciprocal pronoun `each other' and others), suffixes -lc- and -ld- are used rather rarely. ... Assistive means that there is a person (agent) performs an action with someone else (assistee). ...

Еще в разделе: (Показать все результаты (>289) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/letuchiy.pdf
• http://www.philol.msu.ru/~otipl/new/main/people/kibrik-aa/files/Information_channels@CogSci2008.pdf
• Speech rhythm in diachrony and synchrony